DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca4b

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001159683.1 Gene:ca4b / 553246 ZFINID:ZDB-GENE-080815-5 Length:304 Species:Danio rerio


Alignment Length:299 Identity:80/299 - (26%)
Similarity:130/299 - (43%) Gaps:38/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCCTLLLLLARMQVLLAVSWEDWWTYD--------GISGPAFWGLINPEWSLCNKGRRQSPVNLE 63
            ||.:.|.:|.|    ||.|.|  |.|.        ...||..|..:.   :.|. ..:|||:|:.
Zfish     4 LCLSTLAILCR----LASSAE--WCYQTQVTCSNHSCIGPDDWATVA---AACG-NNKQSPINIV 58

  Fly    64 PQRLLFDPNLRPMHID--KHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRF 126
            ..:...|..|.|:...  :.|::.:|.|.||:|..           .:.....|:|..|...|:.
Zfish    59 TNKASTDSRLTPVQFTDYQERLNAVIVNNGHTVQI-----------NLPDRAKINGANLGSTYKA 112

  Fly   127 HEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSN 191
            .::|:|:|.|...||||:::|..||.|:.:.....: |.:...|:..:.|:..:....:..:.:|
Zfish   113 QQLHLHWGKNGGPGSEHTIDGEKFPMELHVVHIKEE-YNSLEQAVGDSSGVAVLGFFYEESENAN 176

  Fly   192 AELRMLTDQLERIRYGGDEAFVKRLSIRGLLP--DTDHYMTYDGSTTAPACHETVTWVVLNKPIY 254
            .....:.:.|..|.:....|.:..:|:..|:|  |.|.|..|:||.|.|.|.|.|.|.:..|.|.
Zfish   177 KNYDAIINSLTNITHPESNAELGAISLDMLIPNEDLDKYFRYEGSLTTPGCAEAVVWTIFEKTIP 241

  Fly   255 ITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPI 293
            ::|:||.|...|....    .|.:.|.:||.|....||:
Zfish   242 LSKEQLSAFSNLTFSD----GAAMVNTFRPIQLRFDRPV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 69/261 (26%)
ca4bNP_001159683.1 alpha_CA_IV_XV_like 50..278 CDD:239391 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.