DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca12

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001016431.1 Gene:ca12 / 549185 XenbaseID:XB-GENE-1015246 Length:335 Species:Xenopus tropicalis


Alignment Length:297 Identity:83/297 - (27%)
Similarity:140/297 - (47%) Gaps:28/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLLARMQVLLAVSWEDWWTYDGISGPAFWGLINPE-WSLCNKGRRQSPVNLEPQRLLFDPNLR 74
            |||:|..:....|.|....|.|.|..|...|    |: :..|. |..|||:::....|.:|.:|:
 Frog     4 LLLVLLALPSCQAASEGHGWAYIGTKGEKSW----PKNYEFCG-GVYQSPIDIHQDILQYDSSLQ 63

  Fly    75 PMHIDKHRISG----LITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYG- 134
            |:.::.:.:|.    .::|.||:|..:           :...:.|...|  :.|...::|:|:| 
 Frog    64 PVKLNGYNVSPAESFTLSNNGHTVQMS-----------LVPTMQIKIAP--FHYTASQLHLHWGQ 115

  Fly   135 LNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTD 199
            ...|.||||.:||..|..|:.:..|||..|::.:.|:..:.|:..:.|||::|.. |.....:..
 Frog   116 RGTQKGSEHCIEGKRFAGEVHLVNYNSDKYSDITTAMKESDGLAVLGILLEVGPF-NPTFEKIIS 179

  Fly   200 QLERIRYGGDEAFVKRLSIRGLLPD-TDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHAL 263
            ||..|.|......:...:::.|||. .|.|..|:||.|.|.|:.:|.|.|...|:.|:::||..|
 Frog   180 QLHSIGYKDQSVQIAGFNVQELLPKRLDEYYRYEGSLTTPPCYPSVLWTVFRNPVTISEEQLITL 244

  Fly   264 RRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNIDFK 300
            ...:..:..:....:.||||..||  |.....::.|:
 Frog   245 ETALYSTDRNESVQMTNNYRQLQP--HGDRLVSVSFR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 73/267 (27%)
ca12NP_001016431.1 alpha_CA_XII_XIV 30..278 CDD:239400 73/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.