DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca7

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001015903.1 Gene:ca7 / 548657 XenbaseID:XB-GENE-1017206 Length:266 Species:Xenopus tropicalis


Alignment Length:274 Identity:89/274 - (32%)
Similarity:148/274 - (54%) Gaps:18/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHID-KHRISGLITNTGHS 93
            |.|....||:.|....|    ..:|.||||:::...:.:|:|:|.|:.|. .|..|..::|.|||
 Frog     7 WGYGEEDGPSEWHHYFP----IAEGNRQSPIDIVSNQAVFNPSLNPLVISYDHCTSINLSNNGHS 67

  Fly    94 VIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFG 158
            |        :..:|.......|:||||...||..:.|.|:|.....||||:|:|.::|.|:.:..
 Frog    68 V--------MVEFDDYDDKTVITGGPLEGSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELHLVH 124

  Fly   159 YNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLP 223
            :|::.|::|.:|.....|:|.:.:.|:.|. .::.|..|||.|..:::.|.:......:.:.|||
 Frog   125 WNARAYSSFGEAAAAPDGLVVIGVFLETGG-QHSGLNRLTDALYMVKFKGTKTQFDDFNPKCLLP 188

  Fly   224 DTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRR--LMQGSPDHPKAPLGNNYRPPQ 286
            .:..|.||.||.|.|..:|:|||:||.:||.::::|:...|:  |..|..:..:..:.||:||||
 Frog   189 SSFEYWTYPGSLTTPPLNESVTWIVLKEPIKVSEKQMERFRKTLLFSGEEEEQRIHMVNNFRPPQ 253

  Fly   287 PLLHRPIRTNIDFK 300
            ||..|.::.:  ||
 Frog   254 PLKGRKVQAS--FK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 85/263 (32%)
ca7NP_001015903.1 alpha_CA_VII 27..264 CDD:239402 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.