DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH5

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001097988.2 Gene:CAH5 / 50102 FlyBaseID:FBgn0040629 Length:302 Species:Drosophila melanogaster


Alignment Length:284 Identity:78/284 - (27%)
Similarity:126/284 - (44%) Gaps:45/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EWS-LCNKGRRQSPVNL--EPQRLLFDPNLRPMHIDKHRISGL-ITNTGHSVIFTAGNDTVANYD 107
            :|: .|..|..|||::|  |..:::..|.||..:.|:...:.| |||.||:     .|..:....
  Fly    51 DWTGTCQSGENQSPIDLIFEDSKIVAIPRLRFNNYDQPLQTPLVITNNGHT-----ANMVIPQTR 110

  Fly   108 GMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALN 172
            |.|.| :|:|..|...:....:|.|:|..:..||||::....:..|:.|...|: :|....:|..
  Fly   111 GGQRP-SINGSLLPGNFEAQSVHFHWGSREAKGSEHAINFQRYDVEMHIVHKNT-IYETMGEATM 173

  Fly   173 RAQGIVGVSILLQLGDLSNAE---LRMLTDQLERI-RYGGDEAFVKRLSIRGLLPD--TDHYMTY 231
            ...|:..:.::.:..|...::   |..:.:||.|| :|..:.....||::..||.:  |..:.||
  Fly   174 HPDGLAVLGVMFRAVDRQTSQHYGLNKIFNQLPRIVQYNSNATITGRLTVGQLLGNIVTGEFFTY 238

  Fly   232 DGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTN 296
            :||.|.|.|.|.|||.|....:...::|:..|..|.    |..:.||.||||..|          
  Fly   239 NGSLTTPDCAEAVTWTVFPDVLDYPRRQITKLWNLR----DSRQRPLINNYRSIQ---------- 289

  Fly   297 IDFKTTKSNGKAACPTMYREVYYK 320
                          .|..|:|||:
  Fly   290 --------------DTNSRDVYYR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 73/260 (28%)
CAH5NP_001097988.2 Carb_anhydrase 43..294 CDD:215000 74/277 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446786
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.