DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH16

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster


Alignment Length:321 Identity:87/321 - (27%)
Similarity:134/321 - (41%) Gaps:73/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQALCCTLLLLLARMQVLLAVSWEDW-WTYDGISGPAFWGLINPEW-SLCNKGRRQSPVNLEPQ- 65
            :||:....||||..:....:.:..:| :..:|           .:| .||:.|:.|||:.|:.: 
  Fly     1 MQAIAFHKLLLLLPLAFYQSTNGMEWNYLKNG-----------KDWEDLCSSGKHQSPILLDSRT 54

  Fly    66 ---------------RLLFDPNLRPMHIDKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVN- 114
                           |||    .||.:         |.|.|||:             .:..||. 
  Fly    55 ARKWVLPGITFWHYYRLL----KRPFY---------IRNNGHSI-------------SLDIPVTS 93

  Fly   115 ------ISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNR 173
                  |:||.|..||....:|.|:|.....||||.:....|.|||.|. :.::.|.|.:.|:.:
  Fly    94 NGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIV-HRNEKYRNIAQAVRQ 157

  Fly   174 AQGIVGVSILLQLGDLSNAE---LRMLTDQLERIRYGGDEAFV-KRLSIRGLLPDTDH--YMTYD 232
            ..|:..|:|::.:....||:   |..|.:.:.|:......|.| .:.|:..|:....|  :.||:
  Fly   158 KDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYE 222

  Fly   233 GSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPI 293
            ||.|.|.|.|||||:|..:...:|...:.....|.    ||....|.||||..|.|.:|.:
  Fly   223 GSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLR----DHWGHRLINNYRIVQDLNNRTV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 79/287 (28%)
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 80/293 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446789
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 1 0.950 - 0 Normalized mean entropy S4838
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.