DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and Ca13

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001128465.1 Gene:Ca13 / 499566 RGDID:1560453 Length:262 Species:Rattus norvegicus


Alignment Length:268 Identity:93/268 - (34%)
Similarity:146/268 - (54%) Gaps:14/268 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRISG-LITNTGHS 93
            |.||..:||..|..:.|    ...|.:|||:.::.:.:.:|.:|||:.|.....|. :|:|:|||
  Rat     6 WGYDEHNGPIHWNELFP----IADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKIISNSGHS 66

  Fly    94 VIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFG 158
              |.      .::|..:....:.||||:..||..:.|:|:|..|..||||.|:|..:.||:.:..
  Rat    67 --FN------VDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVRYAAELHVVH 123

  Fly   159 YNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLP 223
            :||..|.:|.:|.:.:.|:..:.:.||:|: .|.:|:.:||.|:.|:..|.:..........|||
  Rat   124 WNSDKYPSFVEAAHESDGLAVLGVFLQIGE-HNPQLQKITDILDSIKEKGKQTRFTNFDPLCLLP 187

  Fly   224 DTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPL 288
            .:..|.||.||.|.|...|:|||:||.:||.|:.|||...|.|:..:.....|.|.:|:||||||
  Rat   188 SSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAAFLLSNHRPPQPL 252

  Fly   289 LHRPIRTN 296
            ..|.:|.:
  Rat   253 KGRRVRAS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 90/261 (34%)
Ca13NP_001128465.1 alpha_CA_I_II_III_XIII 2..261 CDD:239393 93/268 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339463
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.