DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH6

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster


Alignment Length:293 Identity:83/293 - (28%)
Similarity:132/293 - (45%) Gaps:30/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLLARMQVLLAVSWEDWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRP 75
            |||.||..........|..|.|:  :....||      .:|:.|.||||::|..|:.|..|..|.
  Fly    11 LLLPLAYQHTSNDHKDESHWDYE--TNGQNWG------GICSTGERQSPISLNVQKSLIVPLPRI 67

  Fly    76 M--HIDKHRISGLIT--NTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLN 136
            :  :.|. ::.|.:|  |.||    ||..:.....:| ..|. |:||.|..|:.....|.|:|..
  Fly    68 VFGNYDV-KLRGPLTLLNNGH----TAHVEIPETANG-NKPF-ITGGLLKGRFVAEAFHFHWGSP 125

  Fly   137 DQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSN---AELRMLT 198
            ...|||||:....|..|:.|. :.::.|.:..:|.|:..||..:.::|::....|   ..|..:.
  Fly   126 SSRGSEHSINQQRFDVEMHIV-HRNEKYGDIDEAKNKKDGIAVIGVMLKIVKNPNRIFPGLSKVM 189

  Fly   199 DQLERI-RYGGDEAFVKRLSIRGLLPDTD--HYMTYDGSTTAPACHETVTWVVLNKPIYITKQQL 260
            ..|.|: :|.........||:..:|.:.:  .:.||.||.|.|.|.::|||.|.::.:.:....:
  Fly   190 SALPRVTKYNAKTTIPGGLSLGQMLGNVNPRDFFTYRGSLTTPLCEQSVTWTVFSQVLPVPYSSV 254

  Fly   261 HALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPI 293
            ....:| :.|..|   .|.||:|..||...||:
  Fly   255 SKFWKL-RDSEGH---RLINNFRDIQPRNGRPV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 75/267 (28%)
CAH6NP_001097987.1 Carb_anhydrase 30..282 CDD:215000 75/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446787
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.