DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH4

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster


Alignment Length:278 Identity:66/278 - (23%)
Similarity:112/278 - (40%) Gaps:64/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EWSL-CNKGRRQSPVNLEPQRLLF--DPNLRPMHIDKHRISGL-ITNTGHSVIFTAGNDTVANYD 107
            :|:: |  |.||||:.|.....:.  .|.|:.::..|.....| :.|.|.:|:            
  Fly    29 DWNVKC--GERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVINNGLTVL------------ 79

  Fly   108 GMQTPVNISGGPLS--------YRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLY 164
             |:.|..:.|...|        ..:...::|.|:|.....||||.::|..:..|:.|      ::
  Fly    80 -MRIPKTVDGSRPSLCISTEGQQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHI------VH 137

  Fly   165 ANFSDALNRAQGIV--GVSIL------LQLGDLSNAELRMLTDQLERIRYGGDEAFVK-RLSIRG 220
            .|.|...|:..|:.  |.::|      |:..::....:.|:..|:..|....|...:: .::::.
  Fly   138 KNASYKSNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQD 202

  Fly   221 LLP--DTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQ------QLHALR--RLMQGSPDHPK 275
            |..  |:..|.||.||.|.|.|.|.|.|.|...|:.:.|:      ||...|  |::        
  Fly   203 LFASIDSQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVL-------- 259

  Fly   276 APLGNNYRPPQPLLHRPI 293
                |.||..|....||:
  Fly   260 ----NTYRELQDGHDRPV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 66/278 (24%)
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 64/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446812
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.