DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH8

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001262833.1 Gene:CAH8 / 42625 FlyBaseID:FBgn0038956 Length:303 Species:Drosophila melanogaster


Alignment Length:287 Identity:75/287 - (26%)
Similarity:115/287 - (40%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PAFWGLINPE-WSLCNKGRRQSPVNLEPQRLLFDPNLRPM-------HIDKHRISGLIT--NTGH 92
            |..|    || :..|. |..|||:.:. :|.....||.|:       ..|:     |:|  |:||
  Fly    33 PERW----PEKYPNCG-GSEQSPIAIS-RRKAIPLNLPPLIFALYDEFFDE-----LVTIRNSGH 86

  Fly    93 SVIFTAGNDTVANYDGMQTPVNI-------SGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTF 150
            :|.|             :.|..|       :||.|...|....:|.|:|..:..||||.:.|..|
  Fly    87 TVEF-------------KVPTTIYGVKPYVTGGLLRDCYDAEAVHFHWGSPESKGSEHLLNGRRF 138

  Fly   151 PAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQL---------GDLSNAELRMLTDQLERIRY 206
            ..|:.|...|:: |.|..:|:..:.|:..:::|.::         ..||    .:.:..|....:
  Fly   139 DLEMHIVHRNTK-YLNLEEAVKYSDGVTVLAVLFKVVRSGPFFYQPGLS----EIFSSLLHLGNF 198

  Fly   207 GGDEAFVKRLSIRGLLPDTD--HYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQG 269
            .......:||::..||...|  ::.||.||.|.|.|...|.|.|..:.:.|:.|.|.....|.  
  Fly   199 NASYTVQERLTLGSLLGSLDRGNFYTYKGSLTTPPCSPVVQWHVFGEVLPISHQDLPKFWNLR-- 261

  Fly   270 SPDHPKAPLGNNYRPPQP-----LLHR 291
              |....||..|:||.|.     :.||
  Fly   262 --DERGRPLLKNFRPLQSQENRLIFHR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 75/287 (26%)
CAH8NP_001262833.1 Carb_anhydrase 31..281 CDD:215000 73/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446790
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.