DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH7

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster


Alignment Length:298 Identity:84/298 - (28%)
Similarity:136/298 - (45%) Gaps:49/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCCTLLLLLARMQVLLAVSWEDWWTY---DGISGPAFWGLINPEW-SLCNKGRRQSPVNLEPQRL 67
            :||:           ::.||.:.|.|   |......|     |:| .||:.|::|||:||..:..
  Fly    10 VCCS-----------VSFSWANEWGYPDLDNNQDEPF-----PKWGGLCDSGKKQSPINLHVKGA 58

  Fly    68 L---FDPNLRPMHIDKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEI 129
            |   ||. |:..:.|:|:.:..:.|.|||:          ...|....:.:|||.|...:...:|
  Fly    59 LKGEFDA-LKFENYDEHQKNLRMVNNGHSI----------QLSGFDHELTLSGGALLQDFVVEQI 112

  Fly   130 HMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAEL 194
            |||:      .|||::....:|.|:.|...|: :|.|.:.|.|...|||.:.:|..:.:..|..:
  Fly   113 HMHW------WSEHTINDIRYPLEVHIVHRNT-IYPNMTMAANFKDGIVVIGVLYHVSNTPNEAI 170

  Fly   195 RMLTDQLERIR-YGGDEAFV---KRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYI 255
            ..:...|..:: |......|   ..|::..|:|..::|.||.||.|.|.|.|.|||:||.:...:
  Fly   171 GSIIKSLGAVKSYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPV 235

  Fly   256 TKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPI 293
            |..|::..:.:   ..|..| .|.||||..|...:|.:
  Fly   236 TLDQVNEFKEI---EYDEGK-QLHNNYRELQSENNRAV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 77/265 (29%)
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446822
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.