DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca2

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_954685.2 Gene:ca2 / 387526 ZFINID:ZDB-GENE-031219-5 Length:260 Species:Danio rerio


Alignment Length:274 Identity:88/274 - (32%)
Similarity:141/274 - (51%) Gaps:17/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRISGL-ITNTG 91
            |.|.||..:||..||   ..:.:.| |.||||::::.....:|..|.|:.:.....:.| |.|.|
Zfish     3 DHWGYDKHNGPDKWG---ESYPIAN-GSRQSPIDIKSSTTTYDEKLTPLKLKYDPSTSLDIQNNG 63

  Fly    92 HSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQI 156
            ||...:..:|        |....::|||::..:|..:.|.|:|..|..||||:|.|..:|||:.:
Zfish    64 HSFQVSFVDD--------QNSSTLTGGPVTGTFRLKQFHFHWGSADDKGSEHTVNGKCYPAELHL 120

  Fly   157 FGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGL 221
            ..:|:: |.:|.||:::..|:..|.:.|::| ..|.:|:.:.|.::.|:..|.:..........|
Zfish   121 VHWNTK-YPSFKDAVDKPDGLAVVGVFLKIG-ADNPKLQKILDAMDAIKSKGKQTPFPNFDPSVL 183

  Fly   222 LPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQ 286
            ||.:..|.||.||.|.|...|:|||:|..:.|.::..|:...|.|:..........:.|||||||
Zfish   184 LPSSLDYWTYLGSLTTPPLLESVTWIVCKQSISVSSAQMKRFRSLLFSGDGEKACCMVNNYRPPQ 248

  Fly   287 PLLHRPIRTNIDFK 300
            ||..|.:|.:  ||
Zfish   249 PLKGRVVRAS--FK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 82/261 (31%)
ca2NP_954685.2 alpha_CA 1..259 CDD:320708 86/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579228
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.