DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH15

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster


Alignment Length:271 Identity:72/271 - (26%)
Similarity:121/271 - (44%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRL---LFDPNLRPMHIDKHRISGLITNTG 91
            :.||...||..|.      :.||   .|||:|::...:   .||..|...|.:...:...:.|.|
  Fly    82 YNYDWDQGPHTWD------TACN---NQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRLENNG 137

  Fly    92 HSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQI 156
            |::|..|....       :|| :|.||.|..|:.|.||...:......||||:::.:..|.|:|.
  Fly   138 HTLILRAAFPE-------RTP-SIDGGDLLGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQC 194

  Fly   157 FGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGL 221
            ...:    .:..|..:.:||::.:|.:..|.: .|..|.:|...|..:...|....|....:..|
  Fly   195 LHTD----GDGCDGCSSSQGVLMISYMFDLSE-HNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYL 254

  Fly   222 L-PDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPP 285
            : |..|.:.:|:||.|.|.||....|::..:.:.|:::||:..|:|.    |...:.:..|.||.
  Fly   255 MSPFYDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQLR----DRRGSRIARNARPV 315

  Fly   286 QPLLHRPIRTN 296
            ||:..|.:..|
  Fly   316 QPIGDRMVYLN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 70/264 (27%)
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 71/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446824
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.