DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and Ca12

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:291 Identity:89/291 - (30%)
Similarity:147/291 - (50%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQALCCTLLLLLARMQVLLAVSWEDWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLL 68
            |.|....||::|.......|......|||.|.:|...|   :.::..|. |..|||::|....|.
  Rat     6 LHATVVLLLVILKEQPSSSAPLNGSKWTYIGPAGEKNW---SKKYPSCG-GLLQSPIDLHSDILQ 66

  Fly    69 FDPNLRPMHIDKHRISG----LITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEI 129
            :|.:|.|:....:.:|.    .:||.||||.....:|..  ..|:|          .::||..::
  Rat    67 YDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMY--IQGLQ----------PHQYRAEQL 119

  Fly   130 HMHYG-LNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAE 193
            |:|:| .||..||||:|.|..|.||:.|..|||.||::|..|.::::|:..:::|:::|.: |..
  Rat   120 HLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYSDFGSASDKSEGLAVLAVLIEIGSV-NPS 183

  Fly   194 LRMLTDQLERIRYGGDEAFVKRLSIRGLLPDT-DHYMTYDGSTTAPACHETVTWVVLNKPIYITK 257
            ...:...|:.::|.|.:..:...:|..|||:: ..|..|:||.|.|.|:.||.|.|...|:.|::
  Rat   184 YDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQ 248

  Fly   258 QQLHALRRLMQGSPDHPKAP--LGNNYRPPQ 286
            :||.||...:..:.....:|  :.||:|..|
  Rat   249 EQLLALETALYFTHMDDPSPREMVNNFRQVQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 79/258 (31%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 79/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339443
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.