DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CAH13

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:113/293 - (38%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YDGISGPAFWGLINPEWSLCNKGRR-----------QSPVNLEP---QRLLFDPNLRPMHIDKHR 82
            ||...||..|         ..|.|.           |||||::.   ||:.....|...|.|...
  Fly    85 YDMQHGPHTW---------LPKSRSSSSSVEEATFFQSPVNIDESQIQRMAIRELLSWNHYDDLP 140

  Fly    83 ISGLITNTGHSVIFTA---GNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHS 144
            .|..:.|||.::|..|   ||          .| .|||..|...|.|.|:..|:|..:..||||:
  Fly   141 ASITLENTGQTLILRAQFHGN----------AP-TISGADLLASYTFLELRFHWGWCNSEGSEHT 194

  Fly   145 VEGYTFPAEIQIF-----GYNSQLYANFSDALNRAQGIVGVSILLQLG---DLS--NAELRMLTD 199
            :....||.|:|:.     |......:::.              ||.:|   :||  |..|..|..
  Fly   195 INHRKFPLEMQVMHKTGSGIPRTCTSSYD--------------LLMIGYVFELSAHNPFLDPLVQ 245

  Fly   200 QLERIRYGGDEAFVKRLSIRGLLPD-TDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHAL 263
            .|..::..|....:....|..|:.. ...:.:|.||.|.|.|::...|.:..:.:.|:..||...
  Fly   246 NLRLVQKPGKRVQISPFPISYLMYQFRSGFYSYGGSLTHPPCYQGTEWFIFPESLAISDFQLRHF 310

  Fly   264 RRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTN 296
            |.|:  .|| ..:|:..|.||.|.:.:|.:..|
  Fly   311 RLLL--GPD-GISPIARNSRPVQHMGNRVVSLN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 75/288 (26%)
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 74/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.