DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CARPA

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster


Alignment Length:318 Identity:177/318 - (55%)
Similarity:244/318 - (76%) Gaps:11/318 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCCTLLLLLARMQVLLAVSWEDWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDP 71
            :.|:.::||...:||  .|||:||||||||||:|||||||:|::|||||||||:::.|.:|||||
  Fly    18 IACSAIVLLCSSEVL--SSWEEWWTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDP 80

  Fly    72 NLRPMHIDKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLN 136
            .|||:|||||::||.:.|||.|::|....||       :..||||||||:|||:|.||::|||..
  Fly    81 YLRPLHIDKHKVSGTLHNTGQSLVFRVDKDT-------KQHVNISGGPLAYRYQFEEIYIHYGTE 138

  Fly   137 DQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQL 201
            :..||||.::||:||.||||:|:|.:||.|.|:|.:::|||||:|:::|:|:..|.|||::|...
  Fly   139 NVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTF 203

  Fly   202 ERIRYGGDEAFVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRL 266
            .::.|.|....::.:|:|.|||:||||:||:||||.|.|.|:..|:::|||||||||:|:.||||
  Fly   204 NKVLYRGFSTPIRHISVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRL 268

  Fly   267 MQGSPDHPKAPLGNNYRPPQPLLHRPIRTNIDFKTTKSNGKAACPTMYREVYYKATSW 324
            ||||...||||||||.||.|.|.||.:|||||||..|:  :.|||:||:::||:|..|
  Fly   269 MQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFKRNKN--QYACPSMYKDMYYRANRW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 147/260 (57%)
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 147/260 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45680
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0002299
OrthoInspector 1 1.000 - - mtm6345
orthoMCL 1 0.900 - - OOG6_106561
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1354
1110.880

Return to query results.
Submit another query.