DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and Ca8

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:283 Identity:86/283 - (30%)
Similarity:141/283 - (49%) Gaps:40/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRI---SGLITN 89
            :|...:|:.    |||:.|:    ..|..|||:||..:...:||:|..:.:..:.:   ...:||
  Rat    28 EWGYEEGVE----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTN 84

  Fly    90 TGHSVIFTAGNDTVANYDGMQTPVNISGGPL--SYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPA 152
            .||::.....:.:|           :|||||  ...:..:|:..|:|..:|.||||:|....||.
  Rat    85 DGHTIQVILKSKSV-----------LSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPM 138

  Fly   153 EIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLS 217
            |:.:..:||.|:.:..:|:.:..|||.:::.:|:|. .:..|:.:|:.|:.|:|.|....:...:
  Rat   139 ELHLIHWNSTLFGSIDEAVGKPHGIVIIALFVQIGK-EHVGLKAVTEILQDIQYKGKSKTIPCFN 202

  Fly   218 IRGLLPD--TDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAP--- 277
            ...||||  ...|..|:||.|.|.|.|.|||::...|:.|::.|:...|||.    .|.|..   
  Rat   203 PNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLR----THVKGAELV 263

  Fly   278 ------LGNNYRPPQPLLHRPIR 294
                  ||:|:||.|||..|.||
  Rat   264 EGCDGILGDNFRPTQPLSDRVIR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 84/274 (31%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 84/276 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.