DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and Car15

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:299 Identity:84/299 - (28%)
Similarity:126/299 - (42%) Gaps:33/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CTLLLLLARMQVLLAVSWEDWWTYDGIS---GPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFD 70
            |.||:|.|:      |.....|.||...   |||.|..:.|   .|. |..|||||::.:.:..|
  Rat     9 CFLLMLAAQ------VDSNGTWCYDSQDPKCGPAHWKELAP---ACG-GPTQSPVNIDLRLVQRD 63

  Fly    71 PNLRPM----HIDKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPL-SYRYRFHEIH 130
            ..|:|.    :....:...::.|.||:|:...       :...|....|.|..| |..||..::|
  Rat    64 YALKPFIFHGYDSAPQDPWILENDGHTVLLRV-------HSCQQNCPAIRGAGLPSSEYRLLQLH 121

  Fly   131 MHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELR 195
            .|:|.....||||||:......|:.:...|:: |.:...|.::..|:..:::||...|..|....
  Rat   122 FHWGSPGHKGSEHSVDEKHGSMEMHMVHMNTK-YQSMGHARSQPDGLAILAVLLVEEDKDNTNFS 185

  Fly   196 MLTDQLERIRYGGDEA-FVKRLSIRGLLPDT---DHYMTYDGSTTAPACHETVTWVVLNKPIYIT 256
            .:...|:.:...|... .....::..|||..   ..|..|.||.|.|.|...|.|.|....:.|.
  Rat   186 AIVSGLKNVSSPGVSVNLTSTFALASLLPSALGLLRYYRYSGSLTTPGCEPAVLWTVFENTVPIG 250

  Fly   257 KQQLHALRRLMQGSPD--HPKAPLGNNYRPPQPLLHRPI 293
            ..|:...:.:.|..|.  ||: ||.:|:||.|||..|.|
  Rat   251 HAQVVQFQAVPQTGPPGLHPR-PLTDNFRPQQPLGGRRI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 75/268 (28%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.