DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CA14

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_036245.1 Gene:CA14 / 23632 HGNCID:1372 Length:337 Species:Homo sapiens


Alignment Length:286 Identity:83/286 - (29%)
Similarity:132/286 - (46%) Gaps:23/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLARMQVLLAVSWEDWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPN---LRP 75
            ||..:..:||......|||:|..|...|....||   |. ...|||::::...:.|||:   |:|
Human     6 LLLEVIWILAADGGQHWTYEGPHGQDHWPASYPE---CG-NNAQSPIDIQTDSVTFDPDLPALQP 66

  Fly    76 MHIDKHRISGL-ITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYG-LNDQ 138
            ...|:.....| :.|.||:|             .:..|..:..|.|..:|...::|:|:| ....
Human    67 HGYDQPGTEPLDLHNNGHTV-------------QLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSP 118

  Fly   139 FGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLER 203
            .||||.:......||:.|..|:|..|.:.|:|..|.||:..:.||:::|:..|.....:...|..
Human   119 GGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHE 183

  Fly   204 IRYGGDEAFVKRLSIRGLLP-DTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLM 267
            :|:...:..|...::|.||| ....|..|:||.|.|.|:::|.|.|..:...|:.:||..|:..:
Human   184 VRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTL 248

  Fly   268 QGSPDHPKAPLGNNYRPPQPLLHRPI 293
            ..:.:.|...|..|||..|||..|.:
Human   249 FSTEEEPSKLLVQNYRALQPLNQRMV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 75/263 (29%)
CA14NP_036245.1 alpha_CA_XII_XIV 29..278 CDD:239400 75/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.