DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and cah-6

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_491189.1 Gene:cah-6 / 189049 WormBaseID:WBGene00000284 Length:319 Species:Caenorhabditis elegans


Alignment Length:270 Identity:70/270 - (25%)
Similarity:120/270 - (44%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GRRQSPVNLEPQRLLFDPNLRPMHIDKHRISGLIT--NTGHSVIFTAGNDTVANYDGMQTPVNIS 116
            ||.|||:::.|....|..:|:..|.:       :|  :||.......||......:|..:.:.||
 Worm    65 GRTQSPIDIVPVITAFGEHLQNAHFE-------VTYESTGEFKAVNDGNSIWLMREGNSSELAIS 122

  Fly   117 GGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVS 181
            ..| ..:|....::.|:......||||::.|..:..|:.:...|:: :|..:|||.:..|::.::
 Worm   123 FLP-EEQYHLDAVNFHWATEPMNGSEHTIGGVGYAGEMHLIHRNTR-FATMADALKQPNGVIAIA 185

  Fly   182 ILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLP---DTDHYMTYDGSTTAPACHET 243
            :.|......||....|.:.|.::.|.|.|..:.....:...|   .|..:..|:||.|.....||
 Worm   186 VFLNESHDDNAVFSPLINLLPQVIYKGSECKLCSFDFQTFFPVAEKTKEFWMYEGSETTDPFRET 250

  Fly   244 VTWVVLNKPIYITKQQLHALRRLMQGSPDH---PKAPLGNNYRPPQPLLHRPIRTNIDFKTTKSN 305
            |.|:|:...:.|:..||..||.:..|..|.   .|.|:       :||  |||: |...:|.:|:
 Worm   251 VNWIVIRAALPISSHQLDKLREVRAGRYDEEFSDKVPM-------KPL--RPIQ-NPSSRTIQSS 305

  Fly   306 GK--AACPTM 313
            .:  |..|.:
 Worm   306 FRSVAGAPDL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 66/251 (26%)
cah-6NP_491189.1 alpha_CARP_receptor_like 56..304 CDD:239396 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.