DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and cah-3

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001370788.1 Gene:cah-3 / 181713 WormBaseID:WBGene00000281 Length:246 Species:Caenorhabditis elegans


Alignment Length:287 Identity:89/287 - (31%)
Similarity:121/287 - (42%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTY--DGISGPAFWGLINPEWSLCNKGRRQSPVNL---EPQRLLFDPNLRPMHIDKHRISGLITN 89
            |:|  |...||..|          ..|:.|||:|:   |.:|......::.::.| |.|.|.|.|
 Worm     5 WSYCDDDECGPNRW----------PTGQHQSPINIDLGEVERKDTHDGIKFVNYD-HPIQGDIVN 58

  Fly    90 TGHSVIFTAGNDTVANYDGMQTP------VNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGY 148
            .||||              ..||      ..|.||.|...||..:.|.|:|.||..||||::.|.
 Worm    59 NGHSV--------------QMTPELRSEHPEIYGGGLDQVYRLVQYHFHWGENDNEGSEHTLGGL 109

  Fly   149 TFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGD----LSNAELRML--------TDQL 201
            .:|||:.:      ::....|....|  :|||  .||||.    |||.| |:|        ..::
 Worm   110 RYPAELHL------VHQGVEDPGKLA--VVGV--FLQLGKEGKALSNEE-RVLGKLCNPETVTRV 163

  Fly   202 ERIRYGGDEAFVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRL 266
            |.:|........||           .:..|:||.|.|.|.|.|||.:..:|:.:|..||...|::
 Worm   164 ENVRLSEKLPANKR-----------SFWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELFRQV 217

  Fly   267 MQGSPDHPKAPLGNNYRPPQPLLHRPI 293
            .    |..|.|:..||||.|.|..|.|
 Worm   218 Q----DIEKRPIKKNYRPTQNLNDRKI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 86/278 (31%)
cah-3NP_001370788.1 Carb_anhydrase 5..239 CDD:215000 87/284 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.