DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and cah-4

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_510265.1 Gene:cah-4 / 181478 WormBaseID:WBGene00000282 Length:280 Species:Caenorhabditis elegans


Alignment Length:260 Identity:65/260 - (25%)
Similarity:114/260 - (43%) Gaps:44/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RRQSPVNLEPQRLLFDPNL---RPMHIDKHRISGLITNTGHSVIFTAGN--DTVANYDGMQTPVN 114
            :||||:::.||.:..|.::   ..::||                :.:|:  |.:.:..|....|.
 Worm    50 QRQSPIDIVPQHVCCDTDVCKADALNID----------------YKSGDCCDVLVSEGGFLVNVK 98

  Fly   115 ISGGPL-------SYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALN 172
            .:.|..       |.::...:.|.|:|.|.:.||||.::|.....|:....:|:. |.:|:.||:
 Worm    99 RNCGTFLTANHLPSSKFALAQFHAHWGSNSKEGSEHFLDGKQLSGEVHFVFWNTS-YESFNVALS 162

  Fly   173 RAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDE-AFVKRLSIRGLLPDTD--HYMTYDGS 234
            :..|:..|.:.|:.|.. |.....|.|.:.:....... |..|...|..|||..|  .::||.||
 Worm   163 KPDGLAVVGVFLKEGKY-NDNYHGLIDTVRKATGNATPIAMPKDFHIEHLLPSPDKREFVTYLGS 226

  Fly   235 TTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNIDF 299
            .|.|..:|.|.|.:..:|:.::..||:.||.::..           |:|..|....|.||::.:|
 Worm   227 LTTPPYNECVIWTLFTEPVEVSFGQLNVLRNIIPA-----------NHRACQDRCDREIRSSFNF 280

  Fly   300  299
             Worm   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 64/257 (25%)
cah-4NP_510265.1 alpha_CA 50..275 CDD:238200 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.