DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and cah-5

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_509186.3 Gene:cah-5 / 180972 WormBaseID:WBGene00000283 Length:310 Species:Caenorhabditis elegans


Alignment Length:315 Identity:94/315 - (29%)
Similarity:150/315 - (47%) Gaps:46/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLARMQVLLAV-----SWEDWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDP 71
            ||:|:.:..||.|     ..:..|.||..:||..|      ...|....:|||:::..      |
 Worm     5 LLVLSLLVALLVVVSCGPGSDHGWGYDENNGPDTW------QGKCQNHLKQSPIDIRA------P 57

  Fly    72 N-----LRPMHIDKHRISGLI--TNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEI 129
            :     |..||...:.:.|.|  :|||.: :|..|.::..:...|     |.||.|.:||:..:.
 Worm    58 DVDYALLHRMHFLNYDMDGKIELSNTGRT-LFAGGFESWQHKQPM-----IQGGGLKHRYKLAQF 116

  Fly   130 HMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILL-QLGDLSNAE 193
            |:|:|.||..||||::....:|||:.:......|  ...:||:|..|:..|.:.| :..|....:
 Worm   117 HLHWGQNDAVGSEHAMGSLHYPAELHLVHVREGL--TLKEALSRPDGLAVVGVFLAKTNDPVANK 179

  Fly   194 LRMLTDQLERIRYGGDEAFVKRLSIRGLLP-DTDHYMTYDGSTTAPACHETVTWVVLNKPIYITK 257
            ...::::|..:|:.|::..:|....:.:|| ||:.:..|:||.|.|.|.|.|.|.||.:|:.|:.
 Worm   180 FSPISERLHDLRHSGNKTELKNFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEPMAISS 244

  Fly   258 QQLHALRRLMQGSPDHPK--APLGNNYRPPQPLLHRPIRTNIDFKTTKSNGKAAC 310
            .|||.||:|      |.|  .....||||.|||..|    .|.::.:|.:....|
 Worm   245 HQLHLLRQL------HNKELVKSDKNYRPLQPLNGR----RIQYRPSKLDRAMIC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 82/271 (30%)
cah-5NP_509186.3 Carb_anhydrase 28..275 CDD:215000 85/276 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.