DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and Car11

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:282 Identity:111/282 - (39%)
Similarity:161/282 - (57%) Gaps:19/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDWWTY------DGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDK--HRI 83
            ||||:|      :.:.||.||||:|..||||..|:|||||::|.:|:|:||.|.|:.:..  .::
Mouse    32 EDWWSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKL 96

  Fly    84 SGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGY 148
            .|.:.|||..|.|...:..|         ||:|||||.|.:|..|:.:.:|..|..||||.:...
Mouse    97 RGTLYNTGRHVSFLPASRPV---------VNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHE 152

  Fly   149 TFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAEL-RMLT-DQLERIRYGGDEA 211
            .|.||:|:..:|.:||.|.|.|.....|:..:|:.:.:...||..| |:|. |.:.||.|..|..
Mouse   153 GFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAY 217

  Fly   212 FVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKA 276
            |::.||:..|.|::..::||.||.:.|.|.|||||:::::.:.||..|:|:||.|.|..|.....
Mouse   218 FLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQ 282

  Fly   277 PLGNNYRPPQPLLHRPIRTNID 298
            .|..|.||.|||.||.:|.|.|
Mouse   283 SLSGNGRPLQPLAHRALRGNRD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 105/264 (40%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 105/264 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835782
Domainoid 1 1.000 234 1.000 Domainoid score I2378
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3228
Isobase 1 0.950 - 0 Normalized mean entropy S4838
OMA 1 1.010 - - QHG45680
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0002299
OrthoInspector 1 1.000 - - mtm8832
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.