DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and si:ch211-173d10.4

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_021336146.1 Gene:si:ch211-173d10.4 / 108191769 ZFINID:ZDB-GENE-121214-331 Length:234 Species:Danio rerio


Alignment Length:217 Identity:60/217 - (27%)
Similarity:89/217 - (41%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LITNTGHSV--IFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLND---QFGSEHSV 145
            ::.|.||:|  ...||            .|.:.||.|.::|...:.|.|:|..|   |.|||||:
Zfish     3 MLRNNGHTVECKLKAG------------VVGVQGGGLKHKYTVLQFHFHWGGRDPRQQPGSEHSL 55

  Fly   146 EGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQ-LGDLSNAELRMLTDQLERIRYGGD 209
            ..:.:|.|:.|....:.|  |.|.|.....|...:...:. ..::::.......:.|::|...||
Zfish    56 NRHRWPVEMHIVSRRTDL--NDSAASRVPDGFAVMGFFIDGKENVTSQVWENFMEYLQKIPRKGD 118

  Fly   210 EA-FVKRLSIRGLLP--DTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSP 271
            .. ....:|::.||.  |...|..|.||.|.|.|.|.|.|.|...||.|:..||...:.:     
Zfish   119 TVRITDDISLQQLLTGVDLSRYYRYSGSLTTPPCDEAVQWTVFKDPIIISTDQLLRFQTV----- 178

  Fly   272 DHPKAPLGNNYRPPQPLLHRPI 293
                 ..|..|||.|.|..|.:
Zfish   179 -----SFGYVYRPQQSLNKRTV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 60/217 (28%)
si:ch211-173d10.4XP_021336146.1 alpha_CA 1..196 CDD:320708 60/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.