DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca12

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_009296363.1 Gene:ca12 / 100537787 ZFINID:ZDB-GENE-080815-4 Length:505 Species:Danio rerio


Alignment Length:269 Identity:86/269 - (31%)
Similarity:133/269 - (49%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRISG----LITNT 90
            |||:|:.|...|....|   .|. |..|||::.:...|.:||||.|:.:..:.:|.    .:.|.
Zfish    22 WTYNGLDGEHDWPTNYP---FCG-GAFQSPIDFQTHLLRYDPNLPPIQVQNYNLSTSEQLTLGNN 82

  Fly    91 GHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQF-GSEHSVEGYTFPAEI 154
            ||||             .:..|.::....|.:||...::|.|:|.::.. ||||:|.|..|..|:
Zfish    83 GHSV-------------QLSLPSHMYISSLPHRYSAAQLHFHWGSSNLLTGSEHTVNGKQFAGEM 134

  Fly   155 QIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLER----IRYGGDEAFVKR 215
            .:..:||..|.|.|.|:::..|:..:.:.:::|:.:.|     .|:|.|    ::|...:..|..
Zfish   135 HVVHFNSDKYPNVSMAVDKHDGLAVLGVFIEIGEANPA-----FDKLFRFISGVKYRDQKIQVPA 194

  Fly   216 LSIRGLLPD-TDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGS--PDHPKAP 277
            .:||.|||| .|.|..||||.|.|.|:.:|.|.|..||:.|:::|..||...:..|  .|.|..|
Zfish   195 FNIRALLPDRLDQYYRYDGSLTTPPCYPSVLWTVFRKPVTISRKQFLALATALYASFAQDSPSMP 259

  Fly   278 LGNNYRPPQ 286
            |..|||..|
Zfish   260 LHENYRKSQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 82/262 (31%)
ca12XP_009296363.1 alpha_CA 29..279 CDD:294017 82/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.