DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca6

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_009295179.1 Gene:ca6 / 100006448 ZFINID:ZDB-GENE-030131-7091 Length:538 Species:Danio rerio


Alignment Length:276 Identity:78/276 - (28%)
Similarity:136/276 - (49%) Gaps:29/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKH---RISGLITN 89
            |:|||.|......|.   .::..|. |::|||::::.:::.:.|.::.:.:..:   |.|.|:.|
Zfish    24 DYWTYSGELDQKHWA---EKYHDCG-GQQQSPIDIQRRKVRYSPRMQQLELTGYEDIRGSFLMKN 84

  Fly    90 TGHSVIFTAGNDTVANYDGMQTP--VNISGGPLSYRYRFHEIHMHYGLND--QFGSEHSVEGYTF 150
            .||||             .:|.|  :.|:.| ..::|...::|:|:|..|  ..||||:::|..:
Zfish    85 NGHSV-------------EIQLPSTMKITKG-FPHQYTAVQMHLHWGGWDLEASGSEHTMDGIRY 135

  Fly   151 PAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKR 215
            .||:.:..|||:.|.:|.:|.|:..|:..::...:.|...|.........|..|:|.|....:..
Zfish   136 MAELHVVHYNSEKYPSFEEAKNKPDGLAVLAFFFEDGHFENTYYSDFISNLANIKYVGQSMSISN 200

  Fly   216 LSIRGLLPDT-DHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLG 279
            |::..:|.:. .|:..|.||.|.|.|.|:|.|.|.:.||.::..|   :|:|.....||....|.
Zfish   201 LNVLSMLSENLSHFYRYKGSLTTPPCFESVMWTVFDTPITLSHNQ---IRKLESTLMDHDNKTLW 262

  Fly   280 NNYRPPQPLLHRPIRT 295
            |:||..|||..|.:.:
Zfish   263 NDYRMAQPLNERVVES 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 73/267 (27%)
ca6XP_009295179.1 alpha_CA 33..281 CDD:320708 73/267 (27%)
LamG 332..521 CDD:328935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.