DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and KLF11

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_003588.1 Gene:KLF11 / 8462 HGNCID:11811 Length:512 Species:Homo sapiens


Alignment Length:461 Identity:129/461 - (27%)
Similarity:170/461 - (36%) Gaps:140/461 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SPPPLADAAVGKGFHPWKKSPNSPAAGSSGSSGGGGGGGGSSAGQHSPCAISAASSSSSSGSSGG 126
            :||...|..     .|..::|.||....|                 ..|..:....||:      
Human   107 TPPQSPDLV-----EPSTRTPVSPQVTDS-----------------KACTATDVLQSSA------ 143

  Fly   127 QSSRSLSSSASTMVNITASRPLASS-CAAVGGG---STGSSSSASGSQSSSTASAVAAAYGGDLY 187
            ..:|:||..|..  .:....|:.|| |.|.|..   .||.|.:|.                    
Human   144 VVARALSGGAER--GLLGLEPVPSSPCRAKGTSVIRHTGESPAAC-------------------- 186

  Fly   188 FPNTSTSN---MDNHHMHQGLLGKVEAGAAAFGGVYSRHPYD--WPFNAVTHKEAASVNSGWWDM 247
            ||...|.:   .|:....:.|||..|.       :...|..|  ...|.|:.:..         :
Human   187 FPTIQTPDCRLSDSREGEEQLLGHFET-------LQDTHLTDSLLSTNLVSCQPC---------L 235

  Fly   248 HSAAGSWLDMGG--AGMHSTMANYASENYSS------------------ALSHSLLGSGQHLLQD 292
            |.:.|..|...|  ||....:...:.:||.:                  .|...:..:||..:..
Human   236 HKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP 300

  Fly   293 TYKSMLPGQGVGVGVGVGMGGFSLPHSSPSAAAAAAATAAAAAGGS----------PQGGSPSTP 347
            .:....|...||.             ..|..|.||.|......|.:          |||..| .|
Human   301 AFLKPPPQLSVGT-------------VRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALP-PP 351

  Fly   348 SPRSQRRYAGRATCDCPNCQEAERLGPAGVHL-------------RKKNIHSCHIPGCGKVYGKT 399
            :|.:....|...|...|       |.||.|.:             |::| :.|..|||.|.|.|:
Human   352 APCAANVMAAGNTKLLP-------LAPAPVFITSSQNCVPQVDFSRRRN-YVCSFPGCRKTYFKS 408

  Fly   400 SHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHV 464
            ||||||||.||||:||.|:|..|.|:|.|||||.||.|||||||:|.||||::||||||||.||.
Human   409 SHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHA 473

  Fly   465 KTHNGT 470
            :.|..|
Human   474 RRHMTT 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 14/18 (78%)
zf-H2C2_2 401..428 CDD:290200 18/26 (69%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 16/22 (73%)
zf-C2H2 445..467 CDD:278523 15/21 (71%)
C2H2 Zn finger 447..467 CDD:275368 14/19 (74%)
KLF11NP_003588.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..128 6/23 (26%)
COG5048 393..>449 CDD:227381 36/56 (64%)
zf-C2H2 394..418 CDD:278523 15/23 (65%)
C2H2 Zn finger 399..418 CDD:275368 14/18 (78%)
zf-H2C2_2 410..437 CDD:290200 18/26 (69%)
C2H2 Zn finger 426..448 CDD:275368 13/21 (62%)
zf-H2C2_2 440..463 CDD:290200 16/22 (73%)
zf-C2H2 454..476 CDD:278523 15/21 (71%)
C2H2 Zn finger 456..476 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.