DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and klf13

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001070240.1 Gene:klf13 / 767805 ZFINID:ZDB-GENE-060929-1274 Length:258 Species:Danio rerio


Alignment Length:261 Identity:97/261 - (37%)
Similarity:118/261 - (45%) Gaps:87/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 PHSSPSAAAAAAATAAAAAGGS--PQGGSPSTPSPRSQRRYAGRATCDCPNCQEAERLGPAGVHL 379
            |.::||.....:||..|..|.|  .|.|          :|:.||...|.|               
Zfish    82 PTATPSGDDGNSATPTAIPGDSALKQRG----------KRFRGRVEHDAP--------------- 121

  Fly   380 RKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKR 444
            :||  |.||..||.|||||:||||||||.|||||||.|.|..|.|:|.|||||.||.|||||||:
Zfish   122 QKK--HKCHYSGCEKVYGKSSHLKAHLRTHTGERPFPCTWPDCSKKFARSDELARHYRTHTGEKK 184

  Fly   445 FACPVCNKRFMRSDHLAKHVKTHNGTANHQANGHNGGLKKGSSESCSDSEEAANQSGESNGLGGV 509
            |.||:|:|||||||||.||.:.|                       ||.:.|..:.         
Zfish   185 FGCPLCDKRFMRSDHLMKHARRH-----------------------SDFQPAMLKR--------- 217

  Fly   510 GSGPQTGGAGGGGGGSSSGNGAGTLAVSGSVTTGAGAGSGTGSSNSNSNSGGSSGSVSGSVSGSG 574
                |.||              |..|||.|:.        .||.:..|.|..||.::|.::|.:.
Zfish   218 ----QHGG--------------GNAAVSSSMR--------PGSLSDYSRSDASSPTLSPALSPAN 256

  Fly   575 S 575
            |
Zfish   257 S 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 15/18 (83%)
zf-H2C2_2 401..428 CDD:290200 19/26 (73%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 16/22 (73%)
zf-C2H2 445..467 CDD:278523 15/21 (71%)
C2H2 Zn finger 447..467 CDD:275368 14/19 (74%)
klf13NP_001070240.1 zf-C2H2_8 127..209 CDD:292531 59/104 (57%)
C2H2 Zn finger 127..149 CDD:275368 17/21 (81%)
zf-H2C2_2 141..168 CDD:290200 19/26 (73%)
C2H2 Zn finger 157..179 CDD:275368 13/21 (62%)
zf-H2C2_2 171..194 CDD:290200 16/22 (73%)
C2H2 Zn finger 187..207 CDD:275368 14/19 (74%)
zf-C2H2 187..207 CDD:278523 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.