DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and KLF9

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001197.1 Gene:KLF9 / 687 HGNCID:1123 Length:244 Species:Homo sapiens


Alignment Length:155 Identity:76/155 - (49%)
Similarity:87/155 - (56%) Gaps:24/155 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 SPSAAAAAAATAAAAAGGSPQGGSP-------STPSPRSQRRYAGRATCDCPNCQEAERLGPAGV 377
            ||.....:.:.....:|.|| ..||       |.|||.| ..:.|.|.              .|.
Human    88 SPDEDMGSDSDVTTESGSSP-SHSPEERQDPGSAPSPLS-LLHPGVAA--------------KGK 136

  Fly   378 HLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGE 442
            |..:|. |.|...||||||||:||||||.|.|||||||.|.|..|.|:|:|||||.||.||||||
Human   137 HASEKR-HKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGE 200

  Fly   443 KRFACPVCNKRFMRSDHLAKHVKTH 467
            |:|.||:|.|||||||||.||.:.|
Human   201 KQFRCPLCEKRFMRSDHLTKHARRH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 15/18 (83%)
zf-H2C2_2 401..428 CDD:290200 18/26 (69%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 16/22 (73%)
zf-C2H2 445..467 CDD:278523 15/21 (71%)
C2H2 Zn finger 447..467 CDD:275368 14/19 (74%)
KLF9NP_001197.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..142 16/69 (23%)
COG5048 <94..234 CDD:227381 74/149 (50%)
C2H2 Zn finger 145..167 CDD:275368 16/21 (76%)
C2H2 Zn finger 175..197 CDD:275368 13/21 (62%)
C2H2 Zn finger 205..225 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.