DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and klf9

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001122201.1 Gene:klf9 / 565869 ZFINID:ZDB-GENE-060526-244 Length:216 Species:Danio rerio


Alignment Length:148 Identity:74/148 - (50%)
Similarity:91/148 - (61%) Gaps:10/148 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 RRYAGRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVC 417
            ::.|||.    ...::.:||     |...:..|.|...||||:|||:||||||.|.|||||||.|
Zfish    76 KQTAGRV----KRTRKRDRL-----HASAEKRHCCPYAGCGKIYGKSSHLKAHFRVHTGERPFQC 131

  Fly   418 NWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGTANHQANGHNGGL 482
            .|..|.|:|:|||||.||.|||||||||.||:|:|.|||||||.||.:.|.|.......|| .|.
Zfish   132 TWPGCAKKFSRSDELTRHFRTHTGEKRFMCPLCDKCFMRSDHLTKHARRHAGFHPSMLQGH-AGR 195

  Fly   483 KKGSSESCSDSEEAANQS 500
            ::.||.|.|.|..:.:.|
Zfish   196 RRHSSTSTSSSGSSDHMS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 14/18 (78%)
zf-H2C2_2 401..428 CDD:290200 18/26 (69%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 17/22 (77%)
zf-C2H2 445..467 CDD:278523 14/21 (67%)
C2H2 Zn finger 447..467 CDD:275368 13/19 (68%)
klf9NP_001122201.1 C2H2 Zn finger 101..123 CDD:275368 15/21 (71%)
COG5048 113..>161 CDD:227381 35/47 (74%)
C2H2 Zn finger 131..153 CDD:275368 13/21 (62%)
zf-H2C2_2 145..168 CDD:290200 17/22 (77%)
zf-C2H2 159..181 CDD:278523 14/21 (67%)
C2H2 Zn finger 161..181 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.