DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and klf11a

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_021324131.1 Gene:klf11a / 560787 ZFINID:ZDB-GENE-030131-3568 Length:479 Species:Danio rerio


Alignment Length:183 Identity:79/183 - (43%)
Similarity:96/183 - (52%) Gaps:42/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 LPHSSPSAAAAAAATAAAAAGGSPQG-GSPSTPSPRSQRRYAGRATCDCPNCQEAERLG------ 373
            ||||.|...            |||.. |:.....|:||  .:..:||.    |....||      
Zfish   286 LPHSQPLLV------------GSPVAQGTVMFVVPQSQ--VSQSSTCQ----QSVVTLGNTKLLP 332

  Fly   374 --PAGVHL--------------RKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFC 422
              ||.|::              |::| :.|:..||.|.|.|:||||||||.||||:||.|:|..|
Zfish   333 LAPAPVYVPSGQSSGVTQSDFSRRRN-YVCNFQGCKKTYFKSSHLKAHLRTHTGEKPFSCHWEGC 396

  Fly   423 GKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGTANHQA 475
            .|:|.|||||.||.|||||||:|.||||.:||||||||.||.:.|..|....|
Zfish   397 DKKFARSDELSRHRRTHTGEKKFVCPVCERRFMRSDHLTKHARRHMTTKRSTA 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 13/18 (72%)
zf-H2C2_2 401..428 CDD:290200 18/26 (69%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 16/22 (73%)
zf-C2H2 445..467 CDD:278523 15/21 (71%)
C2H2 Zn finger 447..467 CDD:275368 14/19 (74%)
klf11aXP_021324131.1 MotB_plug <203..345 CDD:330912 20/76 (26%)
C2H2 Zn finger 361..383 CDD:275368 14/21 (67%)
zf-H2C2_2 375..402 CDD:316026 18/26 (69%)
C2H2 Zn finger 391..413 CDD:275368 13/21 (62%)
zf-H2C2_2 405..428 CDD:316026 16/22 (73%)
zf-C2H2 419..441 CDD:306579 15/21 (71%)
C2H2 Zn finger 421..441 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.