DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and klf11b

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001071072.1 Gene:klf11b / 559076 ZFINID:ZDB-GENE-061103-82 Length:458 Species:Danio rerio


Alignment Length:158 Identity:72/158 - (45%)
Similarity:88/158 - (55%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 PQGG----SPSTPSPRSQRRYAGRATCDCPNCQEAER---------LGPAGVHL----------- 379
            |||.    .|.:|...:|:            ||:...         |.||.|::           
Zfish   276 PQGTVMFVMPQSPVSSTQQ------------CQQTVMTLGNTKLLPLAPAPVYVPSGQSSATQVD 328

  Fly   380 --RKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGE 442
              |::| :.|:.|||.|.|.|:||||||||.||||:||.|||..|.|:|.|||||.||.||||||
Zfish   329 FSRRRN-YVCNFPGCRKTYFKSSHLKAHLRTHTGEKPFSCNWEGCDKKFARSDELSRHRRTHTGE 392

  Fly   443 KRFACPVCNKRFMRSDHLAKHVKTHNGT 470
            |:|.||||.:||||||||.||.:.|..|
Zfish   393 KKFVCPVCERRFMRSDHLTKHARRHMTT 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 14/18 (78%)
zf-H2C2_2 401..428 CDD:290200 19/26 (73%)
C2H2 Zn finger 417..439 CDD:275368 14/21 (67%)
zf-H2C2_2 431..454 CDD:290200 16/22 (73%)
zf-C2H2 445..467 CDD:278523 15/21 (71%)
C2H2 Zn finger 447..467 CDD:275368 14/19 (74%)
klf11bNP_001071072.1 COG5048 334..>390 CDD:227381 37/56 (66%)
C2H2 Zn finger 340..359 CDD:275368 14/18 (78%)
zf-H2C2_2 351..378 CDD:290200 19/26 (73%)
C2H2 Zn finger 367..389 CDD:275368 14/21 (67%)
zf-H2C2_2 381..404 CDD:290200 16/22 (73%)
zf-C2H2 395..417 CDD:278523 15/21 (71%)
C2H2 Zn finger 397..417 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.