| Sequence 1: | NP_001259388.1 | Gene: | Sp1 / 31913 | FlyBaseID: | FBgn0020378 | Length: | 726 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_057079.2 | Gene: | KLF13 / 51621 | HGNCID: | 13672 | Length: | 288 | Species: | Homo sapiens |
| Alignment Length: | 257 | Identity: | 95/257 - (36%) |
|---|---|---|---|
| Similarity: | 115/257 - (44%) | Gaps: | 68/257 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 316 LPHSSPSAAAAAAATAAAAAGGSPQGGSPSTPSPRSQRRYAGRATCDCPNCQEAERLGPAGVHLR 380
Fly 381 K-KNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKR 444
Fly 445 FACPVCNKRFMRSDHLAKHVKTHNGTANHQANGHNGGLKKGSSESCSDSEEAANQSGESNGLGGV 509
Fly 510 GSGPQTGGAGGGGGGSSSGNGAGTLAVSGSVTTGAGAGSGTGSSNSNSNSGGSSGSVSGSVS 571 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Sp1 | NP_001259388.1 | C2H2 Zn finger | 390..409 | CDD:275368 | 15/18 (83%) |
| zf-H2C2_2 | 401..428 | CDD:290200 | 19/26 (73%) | ||
| C2H2 Zn finger | 417..439 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 431..454 | CDD:290200 | 16/22 (73%) | ||
| zf-C2H2 | 445..467 | CDD:278523 | 15/21 (71%) | ||
| C2H2 Zn finger | 447..467 | CDD:275368 | 14/19 (74%) | ||
| KLF13 | NP_057079.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 23..57 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..166 | 18/68 (26%) | |||
| COG5048 | <162..252 | CDD:227381 | 61/96 (64%) | ||
| zf-C2H2 | 167..191 | CDD:278523 | 18/23 (78%) | ||
| C2H2 Zn finger | 169..191 | CDD:275368 | 17/21 (81%) | ||
| zf-H2C2_2 | 183..210 | CDD:290200 | 19/26 (73%) | ||
| C2H2 Zn finger | 199..221 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 213..236 | CDD:290200 | 16/22 (73%) | ||
| zf-C2H2 | 227..249 | CDD:278523 | 15/21 (71%) | ||
| C2H2 Zn finger | 229..249 | CDD:275368 | 14/19 (74%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 249..288 | 18/105 (17%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||