DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and Klf15

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster


Alignment Length:159 Identity:60/159 - (37%)
Similarity:77/159 - (48%) Gaps:40/159 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 PHSS---PSAAAAAAATAAAAAGGSPQGGSPSTPSPRSQRRYAGRATCDCPNCQEAERLGPAGVH 378
            |||.   |..:::           ||  ||..:.||                   ||.:.|....
  Fly   153 PHSEIFVPDRSSS-----------SP--GSSDSASP-------------------AEAVAPPSAL 185

  Fly   379 LRKKNI-----HSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRT 438
            ...:|.     :.|....|.|:|.|.:|||||||.|.||:|:||:|..|..||:|||||.||.|:
  Fly   186 QMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRS 250

  Fly   439 HTGEKRFACPVCNKRFMRSDHLAKHVKTH 467
            |:|.|.:.|..|:|.|.|||||.||.|.|
  Fly   251 HSGVKPYKCDYCSKCFARSDHLTKHRKVH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 11/18 (61%)
zf-H2C2_2 401..428 CDD:290200 17/26 (65%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 11/22 (50%)
zf-C2H2 445..467 CDD:278523 12/21 (57%)
C2H2 Zn finger 447..467 CDD:275368 12/19 (63%)
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 44/78 (56%)
C2H2 Zn finger 203..221 CDD:275368 11/17 (65%)
C2H2 Zn finger 229..251 CDD:275368 13/21 (62%)
zf-H2C2_2 243..268 CDD:290200 12/24 (50%)
C2H2 Zn finger 259..279 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.