Sequence 1: | NP_001259388.1 | Gene: | Sp1 / 31913 | FlyBaseID: | FBgn0020378 | Length: | 726 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012051.1 | Gene: | Zfp367 / 306695 | RGDID: | 1307136 | Length: | 340 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 64/200 - (32%) |
---|---|---|---|
Similarity: | 90/200 - (45%) | Gaps: | 38/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 296 SMLPGQGVGVGVGVGM-GGFSLPHSSPSAAAAAAATAAAAAGGSPQGGSPSTPSPRSQ---RRYA 356
Fly 357 GRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLF 421
Fly 422 CGKRFTRSDELQRHLRTHTGEKRFACPV--CNKRFMR------------------SDHLAKHVKT 466
Fly 467 HNGTA 471 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sp1 | NP_001259388.1 | C2H2 Zn finger | 390..409 | CDD:275368 | 6/18 (33%) |
zf-H2C2_2 | 401..428 | CDD:290200 | 15/26 (58%) | ||
C2H2 Zn finger | 417..439 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 431..454 | CDD:290200 | 11/24 (46%) | ||
zf-C2H2 | 445..467 | CDD:278523 | 9/41 (22%) | ||
C2H2 Zn finger | 447..467 | CDD:275368 | 8/39 (21%) | ||
Zfp367 | NP_001012051.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 96..140 | 15/52 (29%) | |
COG5048 | 157..>230 | CDD:227381 | 33/74 (45%) | ||
zf-C2H2 | 158..179 | CDD:278523 | 8/22 (36%) | ||
C2H2 Zn finger | 159..179 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 171..198 | CDD:290200 | 15/26 (58%) | ||
C2H2 Zn finger | 187..209 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 202..228 | CDD:290200 | 13/25 (52%) | ||
C2H2 Zn finger | 217..256 | CDD:275368 | 8/38 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 280..317 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |