DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and Zfp367

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001012051.1 Gene:Zfp367 / 306695 RGDID:1307136 Length:340 Species:Rattus norvegicus


Alignment Length:200 Identity:64/200 - (32%)
Similarity:90/200 - (45%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 SMLPGQGVGVGVGVGM-GGFSLPHSSPSAAAAAAATAAAAAGGSPQGGSPSTPSPRSQ---RRYA 356
            ::.||...|| |..|: ....||  :...|..::|:.||.:||..:..:.|..|...:   ||  
  Rat    76 TLSPGAAGGV-VSAGLPAATELP--TLRGAPPSSASVAAVSGGEDEEEASSPDSGHLKDGIRR-- 135

  Fly   357 GRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLF 421
            ||     |.......|...|.|...:  ..|:|  |.:|:.:...|:||.|.||||||::|::..
  Rat   136 GR-----PRADTVRDLINEGEHSSSR--IRCNI--CNRVFPREKSLQAHKRTHTGERPYLCDYPD 191

  Fly   422 CGKRFTRSDELQRHLRTHTGEKRFACPV--CNKRFMR------------------SDHLAKHVKT 466
            |||.|.:|.:|:.|.|.|||||.|.|..  |..||..                  :|.|:||..|
  Rat   192 CGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRFTHANRHCPKHPYARLKREEPTDTLSKHQST 256

  Fly   467 HNGTA 471
            .|..|
  Rat   257 DNKAA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 6/18 (33%)
zf-H2C2_2 401..428 CDD:290200 15/26 (58%)
C2H2 Zn finger 417..439 CDD:275368 9/21 (43%)
zf-H2C2_2 431..454 CDD:290200 11/24 (46%)
zf-C2H2 445..467 CDD:278523 9/41 (22%)
C2H2 Zn finger 447..467 CDD:275368 8/39 (21%)
Zfp367NP_001012051.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..140 15/52 (29%)
COG5048 157..>230 CDD:227381 33/74 (45%)
zf-C2H2 158..179 CDD:278523 8/22 (36%)
C2H2 Zn finger 159..179 CDD:275368 8/21 (38%)
zf-H2C2_2 171..198 CDD:290200 15/26 (58%)
C2H2 Zn finger 187..209 CDD:275368 9/21 (43%)
zf-H2C2_2 202..228 CDD:290200 13/25 (52%)
C2H2 Zn finger 217..256 CDD:275368 8/38 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.