DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and rsv1

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_596183.1 Gene:rsv1 / 2541322 PomBaseID:SPBP4H10.09 Length:428 Species:Schizosaccharomyces pombe


Alignment Length:226 Identity:56/226 - (24%)
Similarity:82/226 - (36%) Gaps:62/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 SCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVC 450
            |...|.|.:|:.:..|...|:|.||||:||.|::..|.|||||.|||.||:||            
pombe     3 SYECPFCKRVFHRQEHQVRHIRSHTGEKPFECSYPSCKKRFTRRDELIRHVRT------------ 55

  Fly   451 NKRFMRSDHLAKHVKTHNGTANHQANGHNGGLKKGSSESCSDSEEAANQSGESNGLGGVGSGPQT 515
                    ||.|.:.|...|.:...:.......:|...:..:::::.|||.:    |.:....| 
pombe    56 --------HLRKALVTPEQTLDVNLHKAPDSKPEGDKSTGQEADKSQNQSKD----GSITDPVQ- 107

  Fly   516 GGAGGGGGGSSSGNGAGTLAVS------GSVTTG----------------AGAGSGTGSSNSNSN 558
                           |..||:|      .||:..                ..|.:.|||.|..:.
pombe   108 ---------------AAVLALSVAYAKPTSVSLSPTDLQAQSKLIEKPRRRSASNATGSLNKKNQ 157

  Fly   559 SGGSSGSVSGSVSGSGSHPGTPTSLHAHSAN 589
            ......|:|.|...:...|....|....|.|
pombe   158 DPLRRFSISESAGAAAPTPSPSNSKSPPSEN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 6/18 (33%)
zf-H2C2_2 401..428 CDD:290200 14/26 (54%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 6/22 (27%)
zf-C2H2 445..467 CDD:278523 3/21 (14%)
C2H2 Zn finger 447..467 CDD:275368 3/19 (16%)
rsv1NP_596183.1 COG5048 1..427 CDD:227381 56/226 (25%)
zf-C2H2 4..26 CDD:278523 6/21 (29%)
C2H2 Zn finger 6..26 CDD:275368 6/19 (32%)
zf-H2C2_2 21..45 CDD:290200 13/23 (57%)
C2H2 Zn finger 34..56 CDD:275368 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5217
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.