DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and sptf-3

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_493353.3 Gene:sptf-3 / 189783 WormBaseID:WBGene00012735 Length:412 Species:Caenorhabditis elegans


Alignment Length:120 Identity:70/120 - (58%)
Similarity:79/120 - (65%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 RATCDCPNC-QEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLF 421
            |..|.|||| |:..|.|..     |..||.||:  |.|.|||||||:||||.|.|.:||.|:|..
 Worm   293 RCACTCPNCLQQNNRQGDG-----KSRIHICHL--CNKTYGKTSHLRAHLRGHAGNKPFACDWQH 350

  Fly   422 CGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGTANHQAN 476
            |.|:||||||||||.|||||||||||..|.|:|||||||.||.:||.....:..|
 Worm   351 CNKKFTRSDELQRHRRTHTGEKRFACNHCGKKFMRSDHLTKHERTHQSNRINNIN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 13/18 (72%)
zf-H2C2_2 401..428 CDD:290200 15/26 (58%)
C2H2 Zn finger 417..439 CDD:275368 15/21 (71%)
zf-H2C2_2 431..454 CDD:290200 18/22 (82%)
zf-C2H2 445..467 CDD:278523 14/21 (67%)
C2H2 Zn finger 447..467 CDD:275368 12/19 (63%)
sptf-3NP_493353.3 COG5048 <311..406 CDD:227381 61/102 (60%)
C2H2 Zn finger 318..338 CDD:275368 15/21 (71%)
zf-C2H2 344..368 CDD:278523 16/23 (70%)
C2H2 Zn finger 346..368 CDD:275368 15/21 (71%)
zf-H2C2_2 360..383 CDD:290200 18/22 (82%)
zf-C2H2 374..396 CDD:278523 14/21 (67%)
C2H2 Zn finger 376..396 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I7927
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14801
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.