DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and sptf-2

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_495833.1 Gene:sptf-2 / 188733 WormBaseID:WBGene00011926 Length:166 Species:Caenorhabditis elegans


Alignment Length:156 Identity:76/156 - (48%)
Similarity:96/156 - (61%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 SLPHSSPSAAAA-AAATAAAAAGGSPQGGSPSTPSPRSQRRYAGRATCDCPNCQEAERLGPAGVH 378
            |..||.||.:.. :.|:.:|::..|..|.:..|...|...|      |.|||| :|.:.|..|  
 Worm    17 SYHHSLPSISPPDSPASTSASSSSSSIGANELTTKRRKCER------CTCPNC-KAIKHGDRG-- 72

  Fly   379 LRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEK 443
              .::.|.|.:|||||.|.|||||:||||.|||:|||||:|..|||||.|||:|.||.||||.|.
 Worm    73 --SQHTHLCSVPGCGKTYKKTSHLRAHLRKHTGDRPFVCDWFDCGKRFDRSDQLIRHKRTHTKEY 135

  Fly   444 RFACPVCNKRFMRSDHLAKHV-KTHN 468
            ||||..|.::|.|||||.:|: ..||
 Worm   136 RFACKFCIRQFSRSDHLQQHLTSVHN 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 15/18 (83%)
zf-H2C2_2 401..428 CDD:290200 20/26 (77%)
C2H2 Zn finger 417..439 CDD:275368 14/21 (67%)
zf-H2C2_2 431..454 CDD:290200 13/22 (59%)
zf-C2H2 445..467 CDD:278523 11/22 (50%)
C2H2 Zn finger 447..467 CDD:275368 9/20 (45%)
sptf-2NP_495833.1 COG5048 <75..156 CDD:227381 53/80 (66%)
C2H2 Zn finger 82..101 CDD:275368 15/18 (83%)
C2H2 Zn finger 109..131 CDD:275368 14/21 (67%)
C2H2 Zn finger 139..156 CDD:275368 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I8374
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14601
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.