DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp1 and Klf16

DIOPT Version :9

Sequence 1:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_510962.2 Gene:Klf16 / 118445 MGIID:2153049 Length:251 Species:Mus musculus


Alignment Length:178 Identity:81/178 - (45%)
Similarity:94/178 - (52%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 PGQGVGVGVGVGMGGFSLPHSSPSAAAA------AAATAAAAAGG-SPQGGSPSTPSPRSQRRYA 356
            ||.|         |..:.||...::..|      ..||||:.||| ||...|.:..||.|     
Mouse    66 PGPG---------GATAAPHLLAASILADLRGGPVVATAASTAGGTSPVSSSSAASSPSS----- 116

  Fly   357 GRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLF 421
            |||    |...::               |.|...||.|.|.|:||||:|||.|||||||.|:|..
Mouse   117 GRA----PGAAKS---------------HRCPFHGCAKAYYKSSHLKSHLRTHTGERPFACDWPG 162

  Fly   422 CGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNG 469
            |.|:|.|||||.||.|||||||||.||:|.|||.|||||.||.:.|.|
Mouse   163 CDKKFARSDELARHHRTHTGEKRFPCPLCTKRFTRSDHLTKHARRHPG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 12/18 (67%)
zf-H2C2_2 401..428 CDD:290200 18/26 (69%)
C2H2 Zn finger 417..439 CDD:275368 13/21 (62%)
zf-H2C2_2 431..454 CDD:290200 17/22 (77%)
zf-C2H2 445..467 CDD:278523 14/21 (67%)
C2H2 Zn finger 447..467 CDD:275368 13/19 (68%)
Klf16NP_510962.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..72 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..125 15/38 (39%)
COG5048 124..>186 CDD:227381 40/76 (53%)
C2H2 Zn finger 128..150 CDD:275368 13/21 (62%)
zf-H2C2_2 142..169 CDD:290200 18/26 (69%)
COG5048 <158..>231 CDD:227381 36/53 (68%)
C2H2 Zn finger 158..180 CDD:275368 13/21 (62%)
zf-H2C2_2 172..197 CDD:290200 19/24 (79%)
C2H2 Zn finger 188..208 CDD:275368 13/19 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..251 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.