Sequence 1: | NP_511100.1 | Gene: | btd / 31912 | FlyBaseID: | FBgn0000233 | Length: | 644 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011260.1 | Gene: | FZF1 / 852638 | SGDID: | S000003223 | Length: | 299 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 244 | Identity: | 61/244 - (25%) |
---|---|---|---|
Similarity: | 104/244 - (42%) | Gaps: | 51/244 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 KQHICHIPGCERLYGKASHLKTHLRWHTGERPFLC--LTCGKRFSRSDELQRHGRTHTNYRPYAC 393
Fly 394 PICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQAA-AAIKLEKKEKKSGKPLTPPVEFKQE 457
Fly 458 QPDTTPL-----------------VNYAPYA--------------NLYQHSTSAGSSVNPPPPPP 491
Fly 492 PLFQQQMTTTTSSAAASFVEQPWSSSSSRAIQPATTSASSSSSSSASSP 540 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
btd | NP_511100.1 | C2H2 Zn finger | 338..357 | CDD:275368 | 7/18 (39%) |
zf-H2C2_2 | 349..374 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 365..385 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 377..402 | CDD:290200 | 10/24 (42%) | ||
zf-C2H2 | 391..413 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 393..413 | CDD:275368 | 6/19 (32%) | ||
FZF1 | NP_011260.1 | COG5048 | 15..297 | CDD:227381 | 60/239 (25%) |
C2H2 Zn finger | 17..36 | CDD:275368 | 7/18 (39%) | ||
C2H2 Zn finger | 44..66 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 74..94 | CDD:275368 | 6/19 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
2 | 1.870 |