DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and FZF1

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_011260.1 Gene:FZF1 / 852638 SGDID:S000003223 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:61/244 - (25%)
Similarity:104/244 - (42%) Gaps:51/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 KQHICHIPGCERLYGKASHLKTHLRWHTGERPFLC--LTCGKRFSRSDELQRHGRTHTNYRPYAC 393
            :.:.|...|||::|.:.|.|:.|...||.::|:.|  ..|||:|.|...|:.|..||:..:|.||
Yeast    10 RNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKAC 74

  Fly   394 PICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQAA-AAIKLEKKEKKSGKPLTPPVEFKQE 457
            .:|.|:|..:..|.:|..:|  ::|||.....:.|.:.. |.:|.|...|:.|        |..:
Yeast    75 TLCQKRFVTNQQLRRHLNSH--ERKSKLASRIDRKHEGVNANVKAELNGKEGG--------FDPK 129

  Fly   458 QPDTTPL-----------------VNYAPYA--------------NLYQHSTSAGSSVNPPPPPP 491
            .|..:|:                 |...||.              ::.||..::...|   |...
Yeast   130 LPSGSPMCGEEFSQGHLPGYDDMQVLQCPYKSCQKVTSFNDDLINHMLQHHIASKLVV---PSGD 191

  Fly   492 PLFQQQMTTTTSSAAASFVEQPWSSSSSRAIQPATTSASSSSSSSASSP 540
            |..::.:.|:..|::......|..|.|:    ..|:|:.|..|::|.:|
Yeast   192 PSLKESLPTSEKSSSTDTTSIPQLSFST----TGTSSSESVDSTTAQTP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 7/18 (39%)
zf-H2C2_2 349..374 CDD:290200 10/26 (38%)
C2H2 Zn finger 365..385 CDD:275368 8/21 (38%)
zf-H2C2_2 377..402 CDD:290200 10/24 (42%)
zf-C2H2 391..413 CDD:278523 7/21 (33%)
C2H2 Zn finger 393..413 CDD:275368 6/19 (32%)
FZF1NP_011260.1 COG5048 15..297 CDD:227381 60/239 (25%)
C2H2 Zn finger 17..36 CDD:275368 7/18 (39%)
C2H2 Zn finger 44..66 CDD:275368 8/21 (38%)
C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.