DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and Sp6

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001350159.1 Gene:Sp6 / 83395 MGIID:1932575 Length:376 Species:Mus musculus


Alignment Length:411 Identity:127/411 - (30%)
Similarity:168/411 - (40%) Gaps:128/411 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SAPPSLS----GSSSGSSSGSSPLYGKP---------PMKLELPYPQASSTGTASPNSSIQSAPS 151
            ::||.|.    .:..|.:|..:..|..|         |:..|:.:.|......||...:.:...|
Mouse    19 ASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLES 83

  Fly   152 SASVSPSIF-----PSPAQSFASISASPSTPTT------TLAP-------PTTAAAGALAGSPTS 198
            .:.::|..|     |..:..:.| ...|:.|.|      .|.|       |.|..|....|.|.:
Mouse    84 DSPLAPGPFSKLLQPDMSHHYES-WFRPTHPGTEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGA 147

  Fly   199 SSPSSSAASAAAAAAA-----------AAAAAADL-----GAAAVASAAYGWNTAYSGLGPARSQ 247
            ..|:...........|           .||....|     ||.|:.:||            ..||
Mouse   148 LQPALGGYVGDHQLCAPPPHPHPHHLLPAAGGQHLLGPPDGAKALEAAA------------QESQ 200

  Fly   248 FPYAQYASDYYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQLQRRSVR------ 306
                           |:.||.                        |.|.:.:..||||.      
Mouse   201 ---------------GLDSSL------------------------DAASRPKGSRRSVPRSSGQT 226

  Fly   307 -CTCPNCTN-EMSGLPPIVGPDERGRKQHI--CHIPGCERLYGKASHLKTHLRWHTGERPFLC-- 365
             |.||||.. |..|.|  .||| .|:|:|:  ||||||.:.|.|.||||.|||||:|:|||:|  
Mouse   227 VCRCPNCLEAERLGAP--CGPD-GGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNW 288

  Fly   366 LTCGKRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQ 430
            |.|||||:||||||||.:|||..:.:.|.:||:.|.|||||:||.|||           ..|||:
Mouse   289 LFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTH-----------EGAKEE 342

  Fly   431 AAAAIKLEKKEKKSGKPLTPP 451
            ||||   .:.|.|:|..:.||
Mouse   343 AAAA---AQGEGKAGGVVEPP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 12/18 (67%)
zf-H2C2_2 349..374 CDD:290200 19/26 (73%)
C2H2 Zn finger 365..385 CDD:275368 15/21 (71%)
zf-H2C2_2 377..402 CDD:290200 12/24 (50%)
zf-C2H2 391..413 CDD:278523 12/21 (57%)
C2H2 Zn finger 393..413 CDD:275368 12/19 (63%)
Sp6NP_001350159.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 10/50 (20%)
9aaTAD. /evidence=ECO:0000250|UniProtKB:Q3SY56 118..126 1/7 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..224 19/110 (17%)
C2H2 Zn finger 259..278 CDD:275368 12/18 (67%)
COG5048 <261..>336 CDD:227381 46/74 (62%)
C2H2 Zn finger 286..308 CDD:275368 15/21 (71%)
C2H2 Zn finger 316..336 CDD:275368 12/19 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..376 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.