DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and sp3

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_002934651.1 Gene:sp3 / 733736 XenbaseID:XB-GENE-977158 Length:750 Species:Xenopus tropicalis


Alignment Length:421 Identity:129/421 - (30%)
Similarity:180/421 - (42%) Gaps:86/421 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HQQAQQQHMQH----LTQQQQ--QQQQQQQQQQQQQQQQQQPQQQQHDFLSAAALLSAPPSLSGS 108
            |.|....|..:    :|.:.|  |....|...||...|..||..|.....|.|.  .|..::.|.
 Frog   320 HVQTSDLHGNYIQTSMTDESQNIQVSASQTMVQQIHLQDSQPTSQAQLVQSIAQ--QAIQAVQGG 382

  Fly   109 SSGSSSGSSPLYGKPPMKLELPYPQASSTGTASPNSSIQSAPSSASV-SPSIFPSPAQSFASISA 172
            :.|.||                        .|..|..:|..|.:..: :.::.||...::.:...
 Frog   383 TQGLSS------------------------QALQNLQLQLNPGTFLIQAQTVTPSGQIAWQTFQV 423

  Fly   173 ------------SPSTPTTTLAPPTTAAAGALAGSPTSSSPSSSAASAAAAAAAAAAAAADLGAA 225
                        :.|....||.|..|...|.:||..|   |.|..|............:.|   |
 Frog   424 QGVQNLQNLQIPNSSAQQITLTPVQTLTLGQVAGGGT---PVSLNAGQLPNLQTVTVNSVD---A 482

  Fly   226 AVASAAYGWNTAYSGLGPARSQFPYAQYASDYYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFN 290
            |.....:|.|        :.|......:.:..:.:::.:|:.......:|.....|........|
 Frog   483 AGIHLHHGDN--------SDSPTEIETHQTRQHFSSLQLSNFGIRIKEEEPDPDEWQLAGDSTVN 539

  Fly   291 FDDIAF--------------QTQLQRRSVRCTCPNCTNEMSGLPPIVGPDERGRKQHICHIPGCE 341
            .:|:..              |...:.|.|.|||||| .:.:|....:|.    :||||||||||.
 Frog   540 TNDLTHLRVQVVDDELDQPNQEGKRLRRVACTCPNC-KDGAGRGTNLGK----KKQHICHIPGCG 599

  Fly   342 RLYGKASHLKTHLRWHTGERPFLC--LTCGKRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSD 404
            ::|||.|||:.|||||:|||||:|  :.|||||:||||||||.||||..:.:.||.|||:|.|||
 Frog   600 KVYGKTSHLRAHLRWHSGERPFVCTWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSD 664

  Fly   405 HLSKHKKTHFKDKK----SKKVLAA-EAKEQ 430
            ||:||.||| ::||    |..|||: |||.:
 Frog   665 HLAKHIKTH-QNKKGIHASSAVLASIEAKPE 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 12/18 (67%)
zf-H2C2_2 349..374 CDD:290200 18/26 (69%)
C2H2 Zn finger 365..385 CDD:275368 15/21 (71%)
zf-H2C2_2 377..402 CDD:290200 15/24 (63%)
zf-C2H2 391..413 CDD:278523 14/21 (67%)
C2H2 Zn finger 393..413 CDD:275368 14/19 (74%)
sp3XP_002934651.1 C2H2 Zn finger 593..615 CDD:275368 15/21 (71%)
zf-H2C2_2 607..634 CDD:372612 18/26 (69%)
C2H2 Zn finger 623..645 CDD:275368 15/21 (71%)
zf-H2C2_2 637..660 CDD:372612 14/22 (64%)
zf-C2H2 651..673 CDD:333835 14/21 (67%)
C2H2 Zn finger 653..673 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.