DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and SP4

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_003103.2 Gene:SP4 / 6671 HGNCID:11209 Length:784 Species:Homo sapiens


Alignment Length:486 Identity:158/486 - (32%)
Similarity:213/486 - (43%) Gaps:105/486 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PYAQQHQAQQQQHAQ--HQQHAQQQQHHLH---------MQQAQHHLHLSHQQAQQQHMQHLTQQ 64
            |.|.:.:||.....|  ..|:||.|.:.|.         :||.|      .||.|||.:|.:..|
Human   365 PAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVGQPILQQIQ------IQQPQQQIIQAIPPQ 423

  Fly    65 QQQQQQQQQQQQQQQQQQQQPQQQQHDFLSAAALLSAPPSLSGSSSGSSSGSSPLYGKPPMKLEL 129
            ..|.|..|..|..|||..|..|.|.   ::...:|...|:|  :.||..|..:         :::
Human   424 SFQLQSGQTIQTIQQQPLQNVQLQA---VNPTQVLIRAPTL--TPSGQISWQT---------VQV 474

  Fly   130 PYPQASSTGTASPNSSIQSAPSSASVSPSIFPSPAQSFASISASPSTPTTTLAPPTTAAAGALAG 194
            ...|:.|      |..:|:|..|..:  :|.|        :|:|..|....:||.      |:||
Human   475 QNIQSLS------NLQVQNAGLSQQL--TITP--------VSSSGGTTLAQIAPV------AVAG 517

  Fly   195 SPTSSSPSSSAASAAAAAAAAAAAAADLGAAAV--------ASAAYGWNTAYSGLGPARSQFPYA 251
            :|.    :.:.|..|:.......:.|:||||.|        .::..|......|:...::.....
Human   518 API----TLNTAQLASVPNLQTVSVANLGAAGVQVQGVPVTITSVAGQQQGQDGVKVQQATIAPV 578

  Fly   252 QYASDYYGNA-VGMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQLQRRSVRCTCPNCTNE 315
            ..|.....|| :|..|       .::|.|....|   |....|...|...:.|.|.|:|||| .|
Human   579 TVAVGGIANATIGAVS-------PDQLTQVHLQQ---GQQTSDQEVQPGKRLRRVACSCPNC-RE 632

  Fly   316 MSGLPPIVGPDERG-RKQHICHIPGCERLYGKASHLKTHLRWHTGERPFLC--LTCGKRFSRSDE 377
            ..|.    |.:|.| :|||||||.||.::|||.|||:.|||||||||||:|  :.|||||:||||
Human   633 GEGR----GSNEPGKKKQHICHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDE 693

  Fly   378 LQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQ------------ 430
            ||||.||||..:.:.||.|||:|.||||||||.|||...|.....||.....:            
Human   694 LQRHRRTHTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSSVTEVLGSP 758

  Fly   431 ---AAAAIKLEKKEKKSGKPLTPPVEFKQEQ 458
               ..|||      .:...|.||.|....|:
Human   759 RIVTVAAI------SQDSNPATPNVSTNMEE 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 11/18 (61%)
zf-H2C2_2 349..374 CDD:290200 19/26 (73%)
C2H2 Zn finger 365..385 CDD:275368 15/21 (71%)
zf-H2C2_2 377..402 CDD:290200 15/24 (63%)
zf-C2H2 391..413 CDD:278523 15/21 (71%)
C2H2 Zn finger 393..413 CDD:275368 15/19 (79%)
SP4NP_003103.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..150
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..390 8/24 (33%)
9aaTAD, inactive. /evidence=ECO:0000269|PubMed:31375868 467..475 1/16 (6%)
zf-C2H2 647..671 CDD:333835 16/23 (70%)
C2H2 Zn finger 649..671 CDD:275368 14/21 (67%)
zf-C2H2 677..701 CDD:333835 16/23 (70%)
C2H2 Zn finger 679..701 CDD:275368 15/21 (71%)
zf-H2C2_2 693..716 CDD:372612 14/22 (64%)
zf-C2H2 707..729 CDD:333835 15/21 (71%)
C2H2 Zn finger 709..729 CDD:275368 15/19 (79%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.