DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and klf9

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001122201.1 Gene:klf9 / 565869 ZFINID:ZDB-GENE-060526-244 Length:216 Species:Danio rerio


Alignment Length:85 Identity:50/85 - (58%)
Similarity:60/85 - (70%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 KQHICHIPGCERLYGKASHLKTHLRWHTGERPFLCL--TCGKRFSRSDELQRHGRTHTNYRPYAC 393
            |:|.|...||.::|||:||||.|.|.|||||||.|.  .|.|:|||||||.||.||||..:.:.|
Zfish    97 KRHCCPYAGCGKIYGKSSHLKAHFRVHTGERPFQCTWPGCAKKFSRSDELTRHFRTHTGEKRFMC 161

  Fly   394 PICSKKFSRSDHLSKHKKTH 413
            |:|.|.|.|||||:||.:.|
Zfish   162 PLCDKCFMRSDHLTKHARRH 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 11/18 (61%)
zf-H2C2_2 349..374 CDD:290200 16/26 (62%)
C2H2 Zn finger 365..385 CDD:275368 13/21 (62%)
zf-H2C2_2 377..402 CDD:290200 13/24 (54%)
zf-C2H2 391..413 CDD:278523 12/21 (57%)
C2H2 Zn finger 393..413 CDD:275368 12/19 (63%)
klf9NP_001122201.1 C2H2 Zn finger 101..123 CDD:275368 12/21 (57%)
COG5048 113..>161 CDD:227381 29/47 (62%)
C2H2 Zn finger 131..153 CDD:275368 13/21 (62%)
zf-H2C2_2 145..168 CDD:290200 12/22 (55%)
zf-C2H2 159..181 CDD:278523 12/21 (57%)
C2H2 Zn finger 161..181 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.