DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and hkb

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster


Alignment Length:313 Identity:95/313 - (30%)
Similarity:123/313 - (39%) Gaps:94/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 MKLELPYPQASSTGTASPNSSIQSAPSSASVSPSIFPS---PAQSFASISASPSTPTTTLAPPTT 186
            :|.||    |||:.....:....||.||||.|.:...|   .|.:.:|.:.: |||....||   
  Fly    43 IKTEL----ASSSFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRT-STPLLDAAP--- 99

  Fly   187 AAAGALAGSPTSSSPSSSAASAAAAAAAAAAAAADLGAAAVASAAYGWNTAYSGLGPARSQFPYA 251
                    .|..|.|.||.....|||.|:                         |.|.....|:.
  Fly   100 --------HPVFSHPQSSPLDTHAAATAS-------------------------LAPPNQHAPFL 131

  Fly   252 QYASD-YYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFNFDD-------------IAFQTQLQR 302
            ..||| ||..|...:::|:            :..:.|||..|.             :|...||:.
  Fly   132 SAASDLYYAAAAAAAAAAS------------TPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKA 184

  Fly   303 RSVRCTCPNCTNEMSGLPPIVGPDERGRKQHICHIPGCERLYGKASHLKTHLRWHTGERPFLC-- 365
            .:.|...|                    |:..|  |.|:..:.....||.|:|.|||||||.|  
  Fly   185 LNSRKQRP--------------------KKFKC--PNCDVAFSNNGQLKGHIRIHTGERPFKCDV 227

  Fly   366 LTCGKRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKK 418
            .||||.|:|::||.||.|.||..|||.|..|.|||.|.|||.||.|||...::
  Fly   228 NTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQER 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 6/18 (33%)
zf-H2C2_2 349..374 CDD:290200 17/26 (65%)
C2H2 Zn finger 365..385 CDD:275368 12/21 (57%)
zf-H2C2_2 377..402 CDD:290200 15/24 (63%)
zf-C2H2 391..413 CDD:278523 13/21 (62%)
C2H2 Zn finger 393..413 CDD:275368 12/19 (63%)
hkbNP_524221.1 COG5048 195..>261 CDD:227381 33/67 (49%)
zf-C2H2 195..217 CDD:278523 7/23 (30%)
C2H2 Zn finger 197..217 CDD:275368 7/21 (33%)
zf-H2C2_2 210..236 CDD:290200 17/25 (68%)
C2H2 Zn finger 225..247 CDD:275368 12/21 (57%)
zf-H2C2_2 239..264 CDD:290200 15/24 (63%)
C2H2 Zn finger 255..275 CDD:275368 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.