DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and sp6

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_991195.1 Gene:sp6 / 402928 ZFINID:ZDB-GENE-040426-1824 Length:278 Species:Danio rerio


Alignment Length:257 Identity:81/257 - (31%)
Similarity:122/257 - (47%) Gaps:53/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 GWNTAYSGLGPARSQFPYAQYASDYYGNAVGMSSSAAWFSHQER---LYQPWSSQSYP--GFNFD 292
            ||...::| .||    .:........|...|.|.|.:.::.:.:   |..|.|...:|  ||..:
Zfish    22 GWWDVHTG-APA----GWMDLQGAGLGAGPGQSGSMSSYTAEPQMCCLSPPGSGMHFPPEGFKME 81

  Fly   293 DI------------AFQTQLQRRSV--------------------RCTCPNCTNEMSGLPPIVGP 325
            .:            :|.::.|:.:|                    .|.||||.:..|    :...
Zfish    82 PLPQDLLPLPQASASFSSEEQQDAVAAAGRPKPQRRPSSRAPGQASCRCPNCLSAES----LGNS 142

  Fly   326 DERGRKQHI--CHIPGCERLYGKASHLKTHLRWHTGERPFLC--LTCGKRFSRSDELQRHGRTHT 386
            .:..:::|:  ||||||.:.|.|.||||.|||||:|:|||:|  |.|||||:||||||||.:|||
Zfish   143 GDASKRKHLHNCHIPGCGKAYVKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHT 207

  Fly   387 NYRPYACPICSKKFSRSDHLSKHKKTHFKDKKSKK---VLAAEAKEQAAAAIKLEKKEKKSG 445
            ..:.:.|..|.:.|.|:|||:||.:.|....:|.:   ..||......::|:...|.|..:|
Zfish   208 GAKRFGCSSCPRVFLRADHLAKHMRVHESPSQSTEETHAAAAGTSTGTSSALLRVKTETDNG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 12/18 (67%)
zf-H2C2_2 349..374 CDD:290200 19/26 (73%)
C2H2 Zn finger 365..385 CDD:275368 15/21 (71%)
zf-H2C2_2 377..402 CDD:290200 11/24 (46%)
zf-C2H2 391..413 CDD:278523 9/21 (43%)
C2H2 Zn finger 393..413 CDD:275368 9/19 (47%)
sp6NP_991195.1 zf-C2H2_8 154..240 CDD:292531 49/85 (58%)
C2H2 Zn finger 157..176 CDD:275368 12/18 (67%)
zf-H2C2_2 168..195 CDD:290200 19/26 (73%)
C2H2 Zn finger 184..206 CDD:275368 15/21 (71%)
C2H2 Zn finger 214..234 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.