DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and CG3065

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_611861.1 Gene:CG3065 / 37818 FlyBaseID:FBgn0034946 Length:400 Species:Drosophila melanogaster


Alignment Length:171 Identity:60/171 - (35%)
Similarity:84/171 - (49%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 RKQHICHIPGCERLYGKASHLKTHLRWHTGERPFLCL--TCGKRFSRSDELQRHGRTHTNYRPYA 392
            :::.:|....|.:.|||:|||::||.||||.:||:|.  .|||.|:|||||.||.||||..:|:.
  Fly   106 KRKFVCPYDNCTKSYGKSSHLRSHLTWHTGIKPFVCSEPKCGKGFTRSDELNRHLRTHTGEKPFE 170

  Fly   393 CPICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQAAAAIKLEKK----EKKSG-------- 445
            |..|:|||||||||:||..||.:..|................:|..||    |..||        
  Fly   171 CIQCTKKFSRSDHLTKHLATHDRQLKGSTPKRTVPSSSGGVRLKPPKKQIHSESDSGFHFMAAMV 235

  Fly   446 --------------------KPLT------PPVEFKQEQPD 460
                                :|::      .|::.|.|:|:
  Fly   236 GCGEPSMKHHHQQQQHNQHQQPVSIIDIHHKPIKIKLERPE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 9/18 (50%)
zf-H2C2_2 349..374 CDD:290200 15/26 (58%)
C2H2 Zn finger 365..385 CDD:275368 13/21 (62%)
zf-H2C2_2 377..402 CDD:290200 14/24 (58%)
zf-C2H2 391..413 CDD:278523 13/21 (62%)
C2H2 Zn finger 393..413 CDD:275368 13/19 (68%)
CG3065NP_611861.1 COG5048 99..>400 CDD:227381 60/171 (35%)
C2H2 Zn finger 111..133 CDD:275368 10/21 (48%)
zf-C2H2 139..163 CDD:278523 14/23 (61%)
C2H2 Zn finger 141..163 CDD:275368 13/21 (62%)
zf-H2C2_2 155..180 CDD:290200 14/24 (58%)
C2H2 Zn finger 171..191 CDD:275368 13/19 (68%)
zf-C2H2 346..368 CDD:278523
C2H2 Zn finger 348..368 CDD:275368
zf-H2C2_2 360..385 CDD:290200
C2H2 Zn finger 376..396 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.