DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and Cf2

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:539 Identity:121/539 - (22%)
Similarity:168/539 - (31%) Gaps:242/539 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QQHQAQQQQHA------------QHQQHAQQQQHHLHMQQAQHHLHLSHQQAQQQHMQHLTQQQQ 66
            ||...:||:.|            :..:...::|||....||:||....|||.|||..|   ||:.
  Fly   193 QQGFMEQQEAAVTPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQ---QQEL 254

  Fly    67 QQQQQQQQQQQQQQQQQQPQQQQHDFLSAAALLSAPP---SLSGSSSGSSSGSSP--LYGKPPMK 126
            .:|||::.|:|.||||....||..|.......|..||   .|:.:::|.:..|.|  :..:.|:.
  Fly   255 LEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLS 319

  Fly   127 LELPYPQASSTGTASPNSSIQSAPSSASVSPSIFPSPAQSFASISASPSTPTTTLAPPTTAAAGA 191
            |       |.:|..     :.|.|..|                |.|:|..|    ||   |::|.
  Fly   320 L-------SDSGDV-----VNSVPVYA----------------IQANPGVP----AP---ASSGV 349

  Fly   192 LAGSPTSSSPSSSAASAAAAAAAAAAAAADLGAAAVASAAYGWNTAYSGLGPARSQFPYAQYASD 256
            |.|:.|                    ..|||                                  
  Fly   350 LVGTQT--------------------VPADL---------------------------------- 360

  Fly   257 YYGNAVGMSSSAAWFSHQERLYQPWSSQSYPGFNFDDIAFQTQLQRRSVRCTCPNC--------- 312
                           :|:                              :|..||:|         
  Fly   361 ---------------AHK------------------------------IRHKCPDCPKTFKTPGT 380

  Fly   313 --------TNEMSGLPPIVGPDERGRKQHICHIPGCERLYGKASHLKTHLRWHTGERPFLCLTCG 369
                    |.|....|.        .:.:.|..  |.:.:.:::.||.|.|.||||:||.|..|.
  Fly   381 LAMHRKIHTGEADATPK--------ERPYTCSY--CGKSFTQSNTLKQHTRIHTGEKPFHCGYCE 435

  Fly   370 KRFSRSDELQRHGRTHTNYRPYACPICSKKFSRSDHLSKHKKTHFKDKKSKKVLAAEAKEQAAAA 434
            |.||..|.|.:|.||||..:||.||.|.|:|::...|:.|                        .
  Fly   436 KSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVH------------------------T 476

  Fly   435 IKLEKKEKKSG--------KPLTPPVEFKQEQPDTTPLVNYAPYANLYQHSTSAGSSVNP--PPP 489
            .||.....:.|        .|..||       |.|.|                    .||  |..
  Fly   477 TKLHPLXGRPGGGRQLPVPAPAAPP-------PPTHP--------------------PNPSGPGA 514

  Fly   490 PPPLFQQQMTTTTSSAAAS 508
            ||||.....|.....:||:
  Fly   515 PPPLSADTDTDPKKPSAAA 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 5/18 (28%)
zf-H2C2_2 349..374 CDD:290200 14/24 (58%)
C2H2 Zn finger 365..385 CDD:275368 9/19 (47%)
zf-H2C2_2 377..402 CDD:290200 13/24 (54%)
zf-C2H2 391..413 CDD:278523 8/21 (38%)
C2H2 Zn finger 393..413 CDD:275368 7/19 (37%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 37/116 (32%)
C2H2 Zn finger 368..388 CDD:275368 3/19 (16%)
C2H2 Zn finger 403..423 CDD:275368 6/21 (29%)
C2H2 Zn finger 431..451 CDD:275368 9/19 (47%)
zf-H2C2_2 443..468 CDD:316026 13/24 (54%)
C2H2 Zn finger 459..480 CDD:275368 8/44 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1951
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.