DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and Klf11

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_848134.1 Gene:Klf11 / 194655 MGIID:2653368 Length:502 Species:Mus musculus


Alignment Length:480 Identity:113/480 - (23%)
Similarity:154/480 - (32%) Gaps:204/480 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QQQQQQQQQPQQQQHDFLSAAALLSAPPSLSGSSSGSSSGSSPLYGKPPMKLELPYPQASSTGTA 140
            |:.|.:...|.....|..:|..:.:|.|.|.......|:    |...||...||..|   ||||.
Mouse    59 QRSQMRPLTPVSDSGDVTTAVLMDTAAPDLPKDFHSFST----LCITPPQSPELTEP---STGTP 116

  Fly   141 SPNSSIQSAPSSASVSPSIFPSPAQSFASISASPSTPTTTLAPPTTAAAGALAGSPTSSSPSSSA 205
            .|:..:.|.....:..|   |||                             ||.|.:.|.....
Mouse   117 VPSQVVNSKGCMVTALP---PSP-----------------------------AGGPRTLSKREPL 149

  Fly   206 ASAAAAAAAAAAAAADLGAAAVASAAYGWNTAYSGLGPARSQFP----YAQYASDYYGNAVGMSS 266
            ..|:.::..|...:.               ..::|..||.::||    ..|.|||   :..|   
Mouse   150 EPASGSSCRAVMTSV---------------IRHTGESPAPTRFPTGPTQEQRASD---SGEG--- 193

  Fly   267 SAAWFSHQERLY-----------------------QPWSSQSYPGFNFD-------DIAFQTQLQ 301
                   ||||.                       ||...:|...|..|       ..|.||.|.
Mouse   194 -------QERLLDHLEALQDTRLANGLLVTNLVSCQPCLHKSGGSFPTDKGQQTGWPAAVQTCLP 251

  Fly   302 RR-------------SVRCTCPNCTNEM------SGL---------------------------- 319
            :.             ||..:.|....:|      :||                            
Mouse   252 KNPESDLSRKITPLISVPVSSPPVLCQMIPVAGQNGLFSAFLKPPTQLPAGTIKPILPQAASMSQ 316

  Fly   320 PPIVGP------------------------------------------------------DERGR 330
            |..:||                                                      |...|
Mouse   317 PVFMGPPVPQGTVMLVLPQNTFPQPAACPSSVMAIGNTKLLPLAPAPVFLASSQNCAPQVDFSRR 381

  Fly   331 KQHICHIPGCERLYGKASHLKTHLRWHTGERPFLCL--TCGKRFSRSDELQRHGRTHTNYRPYAC 393
            :.::|:.|||.:.|.|:||||.|||.||||:||.|.  .|.|:|:|||||.||.||||..:.:.|
Mouse   382 RNYVCNFPGCRKTYFKSSHLKAHLRTHTGEKPFTCSWDGCDKKFARSDELSRHRRTHTGEKKFVC 446

  Fly   394 PICSKKFSRSDHLSKHKKTHFKDKK 418
            |:|.::|.|||||:||.:.|...||
Mouse   447 PVCDRRFMRSDHLTKHARRHMTTKK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 12/18 (67%)
zf-H2C2_2 349..374 CDD:290200 16/26 (62%)
C2H2 Zn finger 365..385 CDD:275368 12/21 (57%)
zf-H2C2_2 377..402 CDD:290200 12/24 (50%)
zf-C2H2 391..413 CDD:278523 11/21 (52%)
C2H2 Zn finger 393..413 CDD:275368 11/19 (58%)
Klf11NP_848134.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..156 9/54 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..194 10/37 (27%)
COG5048 382..>439 CDD:227381 32/56 (57%)
zf-C2H2 384..408 CDD:278523 13/23 (57%)
C2H2 Zn finger 389..408 CDD:275368 12/18 (67%)
zf-H2C2_2 400..427 CDD:290200 16/26 (62%)
C2H2 Zn finger 416..438 CDD:275368 12/21 (57%)
zf-H2C2_2 430..453 CDD:290200 11/22 (50%)
zf-C2H2 444..466 CDD:278523 11/21 (52%)
C2H2 Zn finger 446..466 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.