DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btd and sptf-2

DIOPT Version :9

Sequence 1:NP_511100.1 Gene:btd / 31912 FlyBaseID:FBgn0000233 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_495833.1 Gene:sptf-2 / 188733 WormBaseID:WBGene00011926 Length:166 Species:Caenorhabditis elegans


Alignment Length:156 Identity:63/156 - (40%)
Similarity:81/156 - (51%) Gaps:29/156 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 RLYQPWSS-----QSYPGFNFDDIAFQTQL---------------QRRSVRCTCPNCTNEMSGLP 320
            :.::||.|     .|.|..:..|....|..               :|:..|||||||.....|  
 Worm     7 KFFRPWESHGSYHHSLPSISPPDSPASTSASSSSSSIGANELTTKRRKCERCTCPNCKAIKHG-- 69

  Fly   321 PIVGPDERGRKQHICHIPGCERLYGKASHLKTHLRWHTGERPFLC--LTCGKRFSRSDELQRHGR 383
                 |...:..|:|.:|||.:.|.|.|||:.|||.|||:|||:|  ..|||||.|||:|.||.|
 Worm    70 -----DRGSQHTHLCSVPGCGKTYKKTSHLRAHLRKHTGDRPFVCDWFDCGKRFDRSDQLIRHKR 129

  Fly   384 THTNYRPYACPICSKKFSRSDHLSKH 409
            |||....:||..|.::|||||||.:|
 Worm   130 THTKEYRFACKFCIRQFSRSDHLQQH 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btdNP_511100.1 C2H2 Zn finger 338..357 CDD:275368 11/18 (61%)
zf-H2C2_2 349..374 CDD:290200 17/26 (65%)
C2H2 Zn finger 365..385 CDD:275368 13/21 (62%)
zf-H2C2_2 377..402 CDD:290200 11/24 (46%)
zf-C2H2 391..413 CDD:278523 11/19 (58%)
C2H2 Zn finger 393..413 CDD:275368 10/17 (59%)
sptf-2NP_495833.1 COG5048 <75..156 CDD:227381 46/81 (57%)
C2H2 Zn finger 82..101 CDD:275368 11/18 (61%)
C2H2 Zn finger 109..131 CDD:275368 13/21 (62%)
C2H2 Zn finger 139..156 CDD:275368 10/17 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14601
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.